DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4853 and Rasgrf1

DIOPT Version :9

Sequence 1:NP_611222.2 Gene:CG4853 / 36974 FlyBaseID:FBgn0034230 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_035375.1 Gene:Rasgrf1 / 19417 MGIID:99694 Length:1262 Species:Mus musculus


Alignment Length:583 Identity:131/583 - (22%)
Similarity:218/583 - (37%) Gaps:138/583 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ASQATDSD-----ERPVDPLGRQLNQTFSNASLMSSSSAITGSDQVIGSVSSTTIGDKSSNISSC 219
            ||....||     ..|:.|.|:   .|.....|..:||.....:::  .|.: ||.:|..     
Mouse   760 ASLGCSSDSYANIHSPISPFGK---TTLDTGKLCMASSLPKTPEEI--DVPA-TIPEKPG----- 813

  Fly   220 DSGHDGLFHSVSMSAPWSHPRDTLTDSLYCDIPSSADESDAVSILNTHLKITEPFDCQTAPVYAK 284
                       .:||...|..|.|.:....|...|.:::..||                 ||.:.
Mouse   814 -----------ELSASRKHSSDVLKEESEDDQNHSDEDNTEVS-----------------PVKSP 850

  Fly   285 DIPK----------------KGNLDSVVNLLINNNTKDL----RFAFLTTSRLFSPPHQLLSKII 329
            ..||                .|.|.:....|::||...|    .||..|......|.::.:.:.:
Mouse   851 PTPKSFLNRTITEFPFFNYNNGILMTTCRDLVDNNRSTLSATSAFAIATAGANEGPSNKEVFRRM 915

  Fly   330 A-----------KIDNE-------EENVLRLLNEWLDTCPGDFSHELLLQELENKRNVKGLAAFL 376
            :           .||.|       ...||.:|..|:.....||..:..|:        ..:..||
Mouse   916 SLANTGFSSDQRNIDKEFVIRRAATNRVLNVLRHWVTKHTQDFDTDDTLK--------YRVICFL 972

  Fly   377 DGI---PQALAQKDENGRSQLNNLLTKQSSASSLGRQSSIKSLKRFAANVYKTDNVLNNCSSAFE 438
            :.:   |..|.|:    |....|::...:...:..:.|.::.:......| ||:...|:  .|.|
Mouse   973 EEVMHDPDLLTQE----RKAAANIIRTLTLEETTEQHSMLEEVILMTEGV-KTEPFENH--PALE 1030

  Fly   439 LAHQLYAIEYAYLSQIRLEEFV----EILEKDELKTCISQTKAGTLGSNCISQVTIDSYVQWFNQ 499
            :|.||..:::.....|..|||.    ...||.|....|.:|                  .:.||.
Mouse  1031 IAEQLTLLDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKT------------------TKHFNH 1077

  Fly   500 LSYLTATEILKLGKKSQRAQMIDFWVETALECFNTGNFNSLMAILTALNLTAIARLKKTWAKV-Q 563
            :|...|:||::....|.||..|:.||..|..|....|:|:::.|.:::|.:||.||||||.|| :
Mouse  1078 VSNFIASEIIRNEDISARASAIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKVSK 1142

  Fly   564 TTK--FEGLEHQMDPSSNFLNYRSTMKAAVWRSEREMANEIERAIIPFFSLFLKDLHAINESHET 626
            .||  .:.|:..:.....|.|.|.:::            ..:...:|:..::|.||..|.|....
Mouse  1143 QTKSLLDKLQKLVSSDGRFKNLRESLR------------NCDPPCVPYLGMYLTDLVFIEEGTPN 1195

  Fly   627 KLANGYINFEKCLHLGTQLRNFGKWQRLDCPYEQLPSVVSYLL-KAEVLSEDLLMKASYESEP 688
            ...:|.:||.|...:...:|...::|:.....:..|.|:.||| ::.:|.|:.|.::|...||
Mouse  1196 YTEDGLVNFSKMRMISHIIREIRQFQQTTYKIDPQPKVIQYLLDESFMLDEESLYESSLLIEP 1258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4853NP_611222.2 RasGEF_N 288..365 CDD:279012 21/114 (18%)
RasGEF 438..638 CDD:279011 56/206 (27%)
Rasgrf1NP_035375.1 PH-like 19..155 CDD:302622
PH 24..130 CDD:278594
RhoGEF 248..429 CDD:214619
PH-like 435..586 CDD:302622
PH 482..587 CDD:278594
RasGEF_N 638..>687 CDD:279012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 714..738
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 800..854 15/89 (17%)
REM <927..996 CDD:295342 17/80 (21%)
RasGEF 1023..1259 CDD:214539 72/268 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.