DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4853 and rgef-1

DIOPT Version :9

Sequence 1:NP_611222.2 Gene:CG4853 / 36974 FlyBaseID:FBgn0034230 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_505469.3 Gene:rgef-1 / 179344 WormBaseID:WBGene00009100 Length:654 Species:Caenorhabditis elegans


Alignment Length:447 Identity:100/447 - (22%)
Similarity:168/447 - (37%) Gaps:134/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 TSRLFSPPHQLL---SKIIAK------IDNEEE-------NVLRLLNEWLDTCPGDFSHELLLQE 362
            :|::....||.|   .:::|:      :|.|:|       :.|.|.::||.......:|  .:..
 Worm     2 SSKVEEDQHQELLTEDQLVARCVECFDVDEEDEVEDIEFVDALFLSHQWLSDSLSLITH--FVNF 64

  Fly   363 LENKRNVKGLAA--------------FLDGIPQALAQK----------DENGRSQLN-------- 395
            .:..|||:...|              ..|..||..||.          :||.|:.|:        
 Worm    65 YQETRNVEQREAVCRAVSFWIEKFPMHFDAQPQVCAQVVRLKTIAEDINENIRNGLDVSALPSFA 129

  Fly   396 --------NLLTKQSSASSLGRQSSIKSLKRFAANVYKTDNVLNNCSSAFELAHQLYAIEYAYLS 452
                    |.|.||::.|....|:|...:                   :..|:|    |:|..||
 Worm   130 WLRAVSVRNPLAKQTAFSLSFVQASPSDI-------------------STSLSH----IDYRVLS 171

  Fly   453 QIRLEEFVEILEKDELKTCISQTKAGTLGSNCISQVTIDSYVQWFNQLSYLTATEILKLGKKSQR 517
            :|.:.|..:.::...|::|                ..::..:..||.||......||......:|
 Worm   172 RISITELKQYVKDGHLRSC----------------PMLERSISVFNNLSNWVQCMILNKTTPKER 220

  Fly   518 AQMIDFWVETALECFNTGNFNSLMAILTALNLTAIARLKKTWA------KVQTTKFEGLEHQMDP 576
            |:::..:|..|.......|||:||:::..:..:::|||.||:|      |.:.|:...|   :..
 Worm   221 AEILVKFVHVAKHLRKINNFNTLMSVVGGITHSSVARLAKTYAVLSNDIKKELTQLTNL---LSA 282

  Fly   577 SSNFLNYRSTMKAAVWRSEREMANEIERAIIPFFSLFLKDLHAINES----HETKLANGYINFEK 637
            ..||..||..:.|         .|:..|  ||...:.||||.|||.|    .:||.    |:.:|
 Worm   283 QHNFCEYRKALGA---------CNKKFR--IPIIGVHLKDLVAINCSGANFEKTKC----ISSDK 332

  Fly   638 CLHLGTQLRNFGKWQRLDCPYEQLPSVVSYLLKAEVLSEDL------LMKASYESEP 688
            .:.|...|.||..:.:..   ..||.:...|:....:|.|:      :.:.|...||
 Worm   333 LVKLSKLLSNFLVFNQKG---HNLPEMNMDLINTLKVSLDIRYNDDDIYELSLRREP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4853NP_611222.2 RasGEF_N 288..365 CDD:279012 13/66 (20%)
RasGEF 438..638 CDD:279011 54/209 (26%)
rgef-1NP_505469.3 RasGEF 150..388 CDD:214539 69/297 (23%)
EFh 423..473 CDD:238008
EF-hand_7 427..477 CDD:290234
C1 493..542 CDD:237996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.