DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4853 and rapgef4b

DIOPT Version :9

Sequence 1:NP_611222.2 Gene:CG4853 / 36974 FlyBaseID:FBgn0034230 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001108368.1 Gene:rapgef4b / 100141331 ZFINID:ZDB-GENE-080219-4 Length:427 Species:Danio rerio


Alignment Length:300 Identity:57/300 - (19%)
Similarity:96/300 - (32%) Gaps:108/300 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 LGRQSSIKSLKRFAANVYKTDNVLNNCSSAFELAHQLYAIEYAYLSQIRLEEFVEILEKDELKTC 471
            |.|...:|:.::|..|:                           |.||.:..|.|.|||.     
Zfish    36 LARLKGVKAFEKFHPNL---------------------------LQQICMCGFYEYLEKG----- 68

  Fly   472 ISQTKAGTLGSNCISQVTIDSYVQWFNQLSYLTATEILKLGKKSQRAQMIDFWVETALECFNTGN 536
            |:..:.|.:|::            |:..||.....::.:.........:....|.||        
Zfish    69 ITLYRQGDIGTS------------WYAVLSGSLDVKVSETANHQDAVTICTLGVGTA-------- 113

  Fly   537 FNSLMAILTALNLTAIARLKKTWAKVQTTKFEGLEHQMDPSSNFLNYRSTMKAAVWRSERE-MAN 600
            |...:...|..:.|.::|......:::..:|:.|                     |...|: ||.
Zfish   114 FGESILDNTPRHATIVSRENSELLRIEQREFKTL---------------------WEKYRQCMAG 157

  Fly   601 EIERAIIPFFSLFLKDLHAINESHETK--LANGYINFEKCLHLGTQLRNFGKWQRLDCPYEQLPS 663
                .:.|.:.:.  |..|.|.....|  |:|..:||        ..:|..|          :||
Zfish   158 ----LLAPPYGVM--DSGATNGRMPDKDNLSNDPLNF--------MSKNLNK----------VPS 198

  Fly   664 VVSYLLKAE-VLSEDLLMKASYESEPPETGEEKDHYKTLK 702
              ..:|:|| ||...:|.:|     |....:.|.|.||.:
Zfish   199 --EKILRAEKVLRNAILARA-----PHMIRDRKYHLKTYR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4853NP_611222.2 RasGEF_N 288..365 CDD:279012
RasGEF 438..638 CDD:279011 36/202 (18%)
rapgef4bNP_001108368.1 CAP_ED 44..153 CDD:237999 26/181 (14%)
Crp 65..>153 CDD:223736 19/133 (14%)
DEP_Epac 204..332 CDD:239884 11/32 (34%)
CAP_ED 356..>406 CDD:237999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.