DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30103 and NT5E-2

Sequence 1:NP_725682.2 Gene:CG30103 FlyBaseID:FBgn0050103 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster

Alignment Length:532 Identity:239/533 (45%)
Similarity:343/533 (64%) Gaps:13/533 (2%)


  Fly    26 KFTLLHTNDMHSRFDPISDTGGRCKTVDDAMGICFGGFGRVAEAVSAARNTATD---PVIYLNGG 87
            :|.:||.||||:|||..|...|.|...|.....|:|||.|||..|...|..|.:   .|:|||.|
  Fly    32 EFIILHNNDMHARFDQTSVNSGTCPPEDVHTNKCYGGFARVAHEVRKYRKEAQEGGTSVLYLNAG 96

  Fly    88 DSFQGTSWFSVYRGKMVARMLNFLAPDAMALGVHELDDGTDALAEFLNTITFPMVSSNINLINEP 152
            |::.|||||::::.|:.:..||.|.|||::||.||.|:..:.|..|||.:|||:::.|::|...|
  Fly    97 DTYTGTSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLIPFLNEVTFPVLACNLDLSKVP 161

  Fly   153 KLAENANLVTSLVITKGNRKIGIVGYIRPDTKERTQPSNVIFKREVPAINKETKKLKGQGIDIII 217
            :|....:|..|.::.....|:|::||:.||||:.|...:|.|..||.:||.|.||||.|||.|||
  Fly   162 QLKATWHLANSAILETNGTKVGVIGYLTPDTKKLTLNMDVEFNEEVESINVEAKKLKAQGIKIII 226

  Fly   218 ALGHSGYEKDMEIAKRCPDVDIVVGGQSHTFLYSGKAPSKEVSEGPYPTIVVKPDGRKVPVVQAY 282
            |||||||.||:||||.||:||||:||.::||||:|..|..|..:|||||:|.:..|::|||||||
  Fly   227 ALGHSGYLKDLEIAKNCPEVDIVIGGHTNTFLYTGAQPDAEHIDGPYPTMVKQNSGKEVPVVQAY 291

  Fly   283 AYTKYLGNLSLEFDNGGNLLSFKGSPILLNNRFHPRKDVQDFLQLYRQVIDDMERHVVGTTSVYL 347
            |||||||.|.::||..|||:.:.|||||||......:|:.|.|:::|..:..:|:.|||.|.|:|
  Fly   292 AYTKYLGKLHVQFDADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRLEKSVVGHTKVHL 356

  Fly   348 NGDRKSCGYSECNFGNFIADSFVYARVVQTMADRSSWTDASIGLINAGAIRASIDPGETGAITEA 412
            .|::..|...|||.||.|||:.|::|:::.... ..||||:|.::..|.||:||:....||||:.
  Fly   357 EGNKAVCRAEECNLGNLIADAMVFSRLMEEQGG-DFWTDAAISIMQGGGIRSSIEKRSDGAITDN 420

  Fly   413 DVVTVLPFSQDLYYTRISGSQLMKALEHSAQMRSKHMTSAHLQVSGLRLKFNHSLPKGERITEIR 477
            |:::|||:...||...::||.:.:||||.|.:|.|......|||||:|:.||.:.|:|:|:..::
  Fly   421 DILSVLPWGNKLYMVPMTGSTIRRALEHGAALRGKDSDGGFLQVSGIRVVFNSNKPEGQRVVSVQ 485

  Fly   478 ALCSDCQIPHYEAVDTNGYYGVVVTSFLLNGGEGYSFVD----PKRPEVENMTILDRMAVIQYLQ 538
            ..|:.|::|.|..::....|.||:..|||:||:|:...|    |:|  ::|.   |..||.|||.
  Fly   486 VRCAACRVPTYSDLNDTAIYNVVLGEFLLDGGDGHVMRDSAHQPQR--LQNN---DLEAVSQYLN 545

  Fly   539 EHKVIYPEREDR 550
            :...:|||.|.|
  Fly   546 QRDYVYPEIEGR 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30103NP_725682.2 UshA 25..555 CDD:223808 239/533 (45%)
MPP_CD73_N 27..311 CDD:277354 146/287 (51%)
5_nucleotid_C 339..511 CDD:280945 70/172 (41%)
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 146/287 (51%)
nadN 35..520 CDD:211667 223/486 (46%)
5_nucleotid_C 348..519 CDD:280945 70/172 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280603362
eggNOG 1 0.900 E1_COG0737
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 404 1.000 Inparanoid score I1888
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D159192at33208
OrthoFinder 1 1.000 FOG0005290
orthoMCL 1 0.900 OOG5_127246
Panther 1 1.100 P PTHR11575
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.