DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tes and Lmcd1

Sequence 1:NP_611215.1 Gene:Tes FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001008562.1 Gene:Lmcd1 RGDID:1308963 Length:365 Species:Rattus norvegicus

Alignment Length:745 Identity:131/746 (18%)
Similarity:191/746 (26%) Gaps:422/746 (57%)


  Fly    28 QLKRSKLGHEAGA-GAPCAECKDKCPGLDLHFWRKVCRNCKCPKIQHVCPDD--DD--------- 80
            ::::..||.:..| |..|..||..|.|.:.|.|||:|::|||.:.:|....|  ||         
  Rat    11 RVQKMSLGQQQSARGVACLRCKGMCSGFEPHSWRKICKSCKCSQEEHCLSSDLEDDRKIGRLLMD 75

  Fly    81 ---ATGWAQFEILGQIRAKPAYIKIKALASQP-----------VQLEWVPPNAAPDVVTDYMEKL 131
               ||..|:.:....||   .|.:.:.:.:.|           :..||.||.....:...|||.:
  Rat    76 SKYATLTARVKGGDGIR---IYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELI 137

  Fly   132 GTAQIPVAGSDAALKRKMQLELQVPPHDLDAALCDGLTETEAIQLQQYVQKLREQCVGQGVVVRL 196
            ...:.||.|::.||.|:.||..|:|.:|.|.:.|.||.|.|...::::|::.:.:.:|.|.|.  
  Rat   138 PKEKQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAMEEFVKQYKSEALGVGEVA-- 200

  Fly   197 GDRLNHAQVEHVAPALMPTQEAQQTWQSLGLMPVADDTLNELLANPKVAQALASPASAHPKLLVA 261
                            :|.|.        ||                            ||    
  Rat   201 ----------------LPGQG--------GL----------------------------PK---- 209

  Fly   262 FSEPLCESTAQFEENGALRAQTREKLLGISKPALLSLVTHGIVYDKVLGILQEKKLNISRDPKLG 326
                        |||     :|:||                                        
  Rat   210 ------------EEN-----KTQEK---------------------------------------- 217

  Fly   327 PIAEFRKEYVNNPQFRAEINTICPQPPMTPIKSPPGTPFNSPLPLKNPVQIRMGAQMRQDTPMRR 391
                                             |.||...:|                       
  Rat   218 ---------------------------------PEGTETTAP----------------------- 226

  Fly   392 VKFGGVSTIVYDCGLPANTDYDRDPVFAQILQAEPLKHAFQEARAGRAPSSVVISNIPAPVASLA 456
                                                                             
  Rat   227 ----------------------------------------------------------------- 226

  Fly   457 ELRGLNPATRAQLQSVGLDKNMLQSAVSNAPYYDRLFRSLHDKGISHDQCHLLQPMKQVHDWLLD 521
                                                                             
  Rat   227 ----------------------------------------------------------------- 226

  Fly   522 DDQLLDEIDKVFADMANGCKDISYPKPSLGELPTSQSSDSGFHSKPPTPGYGSEDLTAGQGRFAS 586
                          ..||         |||:                                  
  Rat   227 --------------TTNG---------SLGD---------------------------------- 234

  Fly   587 IPGIEDMNMYPSCAGMPEQFQQLRLHGDEASGKNSTRTILCADCNQPIAMGEVAVKADRAGKEIA 651
             |..|...:...|.|:                         |..:.|:      |.|||||....
  Rat   235 -PSKEVEYVCELCKGV-------------------------APADSPV------VYADRAGYSKQ 267

  Fly   652 WHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIK 716
            |||.||.||.|.|.|.||:||:..|..:|||.....|: |||..|||:||:::|...|:..:|.|
  Rat   268 WHPTCFLCIKCSEPLVDLIYFWKDGAPWCGRHYCESLR-PRCSGCDEIIFSEDYQRVEDLAWHRK 331

  Fly   717 HFCCYQCDEPLAGQQYIADEKSNMPLCLLC 746
            ||.|..|::.|:|:.||..:  ...||..|
  Rat   332 HFICEGCEQLLSGRAYIITK--GQLLCPTC 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604 28/87 (32%)
LIM1_Testin_like 627..684 CDD:188726 26/57 (46%)
LIM2_Testin_like 691..748 CDD:188727 23/57 (40%)
LIM 755..810 CDD:295319
Lmcd1NP_001008562.1 PET_testin 116..203 CDD:193604 29/105 (28%)
LIM1_Testin_like 243..300 CDD:188726 28/88 (32%)
LIM 306..359 CDD:295319 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109350725
eggNOG 1 0.900 E1_KOG1704
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2569
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24211
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
87.860

Return to query results.
Submit another query.