DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and FHL1

DIOPT Version :10

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001427698.1 Gene:FHL1 / 2273 HGNCID:3702 Length:339 Species:Homo sapiens


Alignment Length:173 Identity:36/173 - (20%)
Similarity:58/173 - (33%) Gaps:62/173 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 CLLDLVYEIVEEKVLLGQEISRCADDTTDAKDSLPESFYEFLNLLQRLSNSIAETTLYTFVSQNS 175
            |.|.|..::.|.....|...||         |:.|.......|:...||:|    .:..|||.::
Human   523 CSLHLHLKVSENPYTSGIIASR---------DTAPSIIVASGNIGSELSDS----DISMFVSSDA 574

  Fly   176 VN------DPERHLEFLEE-------------------SFEETDRAWN----------------- 198
            .|      :.|..:.:|::                   ||:| .|:|:                 
Human   575 GNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFDE-GRSWSKYSFTSIPLFVDGVLGE 638

  Fly   199 --EEALPLVQFELDAMEYNRPLIVADNAQCLQAINDRQQAFED 239
              ||.|.:..|...:......|:..|    .::|.||:.|.||
Human   639 PGEETLIMTVFGHFSHRSEWQLVKVD----YKSIFDRRCAEED 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604 23/110 (21%)
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727
LIM 755..810 CDD:413332
FHL1NP_001427698.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.