DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and DYNLRB1

DIOPT Version :8

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001306086.1 Gene:DYNLRB1 / 83658 HGNCID:15468 Length:121 Species:Homo sapiens

Alignment Length:82 Identity:60/83 (72%)
Similarity:67/83 (81%) Gaps:0/83 (0%)


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            ||||||||:||.|||.|.||||.||||:|||:||.||.|||.||.....||||.|||:||.||:|
Human     3 EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLT 67

  Fly    69 FLRVRSKKHEIMVAPDK 85
            |||:||||:||||||.|
Human    68 FLRIRSKKNEIMVAPGK 84

Known Domains:


GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 6..94 CDD:308728 58/81 (72%)
DYNLRB1NP_001306086.1 Robl_LC7 4..87 CDD:214939 59/82 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296548527
eggNOG 1 0.900 E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1512428at2759
OrthoFinder 1 1.000 FOG0002147
OrthoInspector 1 1.000 T609234
orthoMCL 1 0.900 OOG5_128122
Panther 1 1.100 O PTHR10779
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3930
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.