DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and CG16837

DIOPT Version :8

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_611916.1 Gene:CG16837 / 37904 FlyBaseID:FBgn0035009 Length:130 Species:Drosophila melanogaster

Alignment Length:80 Identity:34/81 (42%)
Similarity:52/81 (64%) Gaps:0/81 (0%)


  Fly    14 SHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHE 78
            :|:|....:::::.|:|::||.....|..:...:..|...||:||||||||||:||:|:||...|
  Fly    40 AHRGARDIMILDSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMRIRSNMGE 104

  Fly    79 IMVAPDKDFILIVIQ 93
            |.:....||||||:|
  Fly   105 IHMTLGTDFILIVVQ 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 6..94 CDD:308728 34/81 (42%)
CG16837NP_611916.1 Robl_LC7 35..119 CDD:281277 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2020
OrthoDB 1 1.010 D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10779
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.