DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtap and CG18128

Sequence 1:NP_001261049.1 Gene:Mtap FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_611822.1 Gene:CG18128 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster

Alignment Length:221 Identity:46/222 (21%)
Similarity:84/222 (38%) Gaps:22/222 (10%)


  Fly    10 NLDPLPVKIGIIGGSGLDD-PDILEQ----RQERVVETPYG-EPSDALIEGEINGVQCVLLARHG 68
            |:..:..|.|:|.||.|.| ..::||    ..|.:...|.| ||..:.:.|.:.|...:.|....
  Fly    59 NVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEPDCSFVLGTVMGAPIIALVHSF 123

  Fly    69 RKHD-------IMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKR 126
            ...|       .:|..|        ::..|...:::::...::......|::::..|.|:.....
  Fly   124 HSCDGYNLATCALPVRV--------MQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMM 180

  Fly   127 LQTFYDGKAQSPRGVCHLPMFPAFSERTRNILLQAAKELEIPAH-DKATIVTIEGPRFSSRSESH 190
            .||..:|.:....|.....|..|:.:......|:..|.:.|... ....:..:.||...:.:|..
  Fly   181 HQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPILGTVAEER 245

  Fly   191 MFRQWGGDLINMTTCPEVVLAKEAGL 216
            |.|......:.|:..|||:.|...||
  Fly   246 MLRTMEVSAVGMSLVPEVIAAHHGGL 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MtapNP_001261049.1 XapA 12..264 CDD:223084 45/220 (20%)
PNP_UDP_1 17..263 CDD:294213 45/215 (21%)
CG18128NP_611822.1 XapA 50..280 CDD:223084 46/222 (21%)
PNP_UDP_1 46..280 CDD:294213 46/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33388376
eggNOG 1 0.900 E1_COG0005
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I835
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.