DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and BOI2

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_011039.1 Gene:BOI2 SGDID:S000000916 Length:1040 Species:Saccharomyces cerevisiae

Alignment Length:1264 Identity:253/1265 (20%)
Similarity:385/1265 (30%) Gaps:431/1265 (34%)


  Fly   201 PASLNLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSG-------------KIED----- 247
            |....|.|...|:.::...:...:       |.|.::...:.|             ::||     
Yeast     8 PTLSQLNTTVSRDKDVSDTLSPDF-------DSKGSATGRDGGNFPMYIAINEYFKRMEDELDMK 65

  Fly   248 -GDEIVQI----NYQTVVGWQHRTVLEHLREALPDVV----LTVKKRPKHTKMFGQIYMQPYRLP 303
             ||:|..|    .|:.  ||.....|....|.|..||    :||:|.|  |.|         |..
Yeast    66 PGDKIKVITDDEEYKD--GWYFGRNLRTNEEGLYPVVFTQKITVEKAP--TLM---------RAK 117

  Fly   304 SKKRNMAARWAAQMPSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSA--- 365
            |.||         :.||                                   ||..:|:.|:   
Yeast   118 STKR---------IYSP-----------------------------------LTNEDPLLSSTFI 138

  Fly   366 SDSDSSCSDIPTPTDPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGI 430
            |::||: |::|||...:.||...|....|....|..:||:...:...|:..|          ..|
Yeast   139 SENDSN-SELPTPQPIETAASISRTANGKIERNLSLKNTMSDIDNALLEFKD----------DSI 192

  Fly   431 GSPTNCDPGSPSIRDKSISFGY--------GLEMA---ARPTTCIG---IAGDTSTDKARRMFHE 481
            |.|   |....|.||:..|..:        ||::.   ::|||...   :.||...........:
Yeast   193 GPP---DRFINSGRDEEHSITHETILSATDGLDVVESNSKPTTSSSTGFLNGDLENQATLINGID 254

  Fly   482 ARKLKQL------TEDSQREFLVDRYKPGVSKVVRFDAKE---------DYVMKNEKFICNVENT 531
            ..||..:      .|:....|:::.|  .|....||...:         :.|...|..| |...|
Yeast   255 TTKLNPVEAEFWSPEEITAYFIMEGY--DVQSASRFQKHKISGKILLELELVHLKELDI-NSFGT 316

  Fly   532 ILETFEPIPFADEGDEDALET-----LRNCKTENA---EELLEAINLATKG-------------Q 575
            ..|.|:.|    |..::|:.|     .|..||.||   .:|:...|:..:.             :
Yeast   317 RFEIFKEI----EKIKEAIRTNGRSLNRASKTNNANIYNQLMPPANVDQRASYRGHVRKTSQSLE 377

  Fly   576 DLPLAEAINMPLLQQGRRGRLDKSH-------STPAYDNSGEESDTPPAIEPR--KEFLLVTP-- 629
            |||..:.. :|..:..|.....|..       |..|..|...:...|..:|..  .|.|.|:|  
Yeast   378 DLPSQQNF-IPTPRNTRNSSASKHRPKSLVFDSQEANANIAPDVQIPQVVEEMAGNENLFVSPRR 441

  Fly   630 -PAPPPRPRKQREMTPPAVPP---------PPPKPASMQPASSIT-SISIPVPVPVPAAVDPSEI 683
             |.||..|       .||.||         ..|.||.:....|.| |.|.|...   :.:|....
Yeast   442 APKPPSYP-------SPAQPPKSPLLNNTRTSPSPAQLYSWQSPTLSFSGPKRT---SYIDQYSS 496

  Fly   684 SELHTPSKSRTLTLKKKHS--------LMAKRRNTNLKLLGTGDIQGHLYRRKKNHRGVTYWARI 740
            |:.:..|:|   .|.|.:.        :.:..||:    :...|.:|.|....|.: .|.|    
Yeast   497 SDSNFNSRS---ALPKNNQGGGKALSPIPSPTRNS----VRNEDSEGKLTSSSKRN-SVPY---- 549

  Fly   741 YFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYHTAKSFYFAAESLDALNQ 805
                     ||:..:.|:.              .|...|.....:...|..:|.....|:     
Yeast   550 ---------YGYAPESSSD--------------RKSSCSSHEEEQFQETMNTFERPTSSI----- 586

  Fly   806 WVDFLRQASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLS 870
            :.|....||:........|.|......:|.:.||..:.|:....:|        |.|.|.|.|.|
Yeast   587 YADGSTIASISNDKLAHEKEGKKKPTRHSSSLSSKSKSDSRRNSSL--------KRSSSASRTSS 643

  Fly   871 GGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTP 935
                     .|.....|..||:   .|..:||:.||    |.|.                     
Yeast   644 ---------FKKSSFMLSPFRQ---QFTDNAARSSS----PEEN--------------------- 671

  Fly   936 GYHDPAMPPTQIP------PLVGPKLSRSS-SRSSVVSGTESAV------------SLSASILGP 981
                   |.|.:|      |:|..|.|:.| |:...||..|:.:            |.|.:|.|.
Yeast   672 -------PITSMPSEKNSSPIVDKKSSKKSRSKRRSVSAKEAEIFTETVKDDKNKRSASEAIKGE 729

  Fly   982 PASPAPTPTPTATPTSLQHQSSEESPSQSQSQSPSSKSSLKKAPFNFLHASNPNLVEFDFHTSKT 1046
            ..........||.|.:.:.|:|.....   .:|.|.|.::|.|             :|....||.
Yeast   730 TLKGKSLRQMTARPVAKKKQTSAFIEG---LRSISVKEAMKDA-------------DFSGWMSKK 778

  Fly  1047 LLPKMSVGNT---LDHGHNIQGFVTLKDLMLR-------------KQEEEAQEMY---------- 1085
            ....||...|   ..||..:..|.:..|...|             |::::...:|          
Yeast   779 GSGAMSTWKTRFFTLHGTRLSYFSSTTDTRERGLIDITAHRVVPAKEDDKLVSLYAASTGKGRYC 843

  Fly  1086 -----------------NNRVH-LGVEKHKHARTESTASQQSAMSSSVTKPLEKLPKIQSVSLPK 1132
                             ..|.| ..|:..:..|....|..::.:....:.|:     |.|.:.| 
Yeast   844 FKLLPPQPGSKKGLTFTQPRTHYFAVDNKEEMRGWMAALIKTTIDIDTSVPI-----ISSYTTP- 902

  Fly  1133 TPDYEISFKPDDESIKRTRTKEGQKLRDFGYELICGDEPSTSSISRQEHHHHHHHHQHHLQHVQQ 1197
                .:|.....|.:...|  |..|||:                  |:...:.......|...||
Yeast   903 ----TVSLSKAQEMLAEAR--EETKLRE------------------QQMLENEEDEDQFLWDQQQ 943

  Fly  1198 QQQLQHQQTQ----------QQHSSKAKHFLRSQQLQLSSFLHKNSSG--------------GSG 1238
            .||.||...|          .|.:|...:.:.:..|..::.....|:|              |..
Yeast   944 LQQQQHDNNQGQADRTISASTQRTSDEDNTISTPNLSSANNTTIGSNGFSSPFLLASGLLSPGVA 1008

  Fly  1239 KSSGSGADQKKSKGKSSGDRRFPFSKHST 1267
            ::|.....:||.|..:..|.....|||.|
Yeast  1009 RNSSMRGTEKKGKFSTEEDYFGDNSKHKT 1037

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492 22/104 (21%)
PH 720..814 CDD:278594 15/94 (16%)
PH_CNK_insect-like 720..810 CDD:270135 14/90 (16%)
BOI2NP_011039.1 SH3_BOI 47..101 CDD:212819 14/56 (25%)
SAM 263..329 CDD:197735 15/73 (21%)
SAM_BOI-like_fungal 264..328 CDD:188934 15/71 (21%)
PH_Boi 770..886 CDD:270126 18/116 (16%)
PH 772..884 CDD:278594 17/112 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.