DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and BOI1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_009468.1 Gene:BOI1 SGDID:S000000181 Length:980 Species:Saccharomyces cerevisiae

Alignment Length:877 Identity:170/878 (19%)
Similarity:260/878 (30%) Gaps:306/878 (35%)


  Fly   776 EVHSKPHAFKVYHTAKSFYFAAES----LDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSEN 836
            |::|....|:::...::...|.:|    |||......|..||:..:|.:|.:      :|...:.
Yeast   272 EINSFGIRFQIFKEIRNIKSAIDSSSNKLDADYSTFAFENQAAQLMPAATVN------RDEIQQQ 330

  Fly   837 DSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSSA 901
            .||  :|:.|       .|...:::|.|::..|.   .|||..:                     
Yeast   331 ISS--KCNKL-------SSESSDRKSSSVTTELQ---RPSSVVV--------------------- 362

  Fly   902 AKPSSDIPVPTEQYRSYRKVPGGSFGIQI------GANTPGYHDPAMPPTQIPPLVGPKLSRSSS 960
             .|:..:..|.||.....:||.......|      ....|.|..|..||..  |....:.:.:::
Yeast   363 -NPNFKLHDPAEQILDMTEVPNLFADKDIFESPGRAPKPPSYPSPVQPPQS--PSFNNRYTNNNA 424

  Fly   961 RSSVVSGTESAVSLSASILGPPAS--PAPTPTPTATPTSLQHQSSEES---------PSQSQSQS 1014
            |.                  ||.:  |.....||.....|...||..|         |:.:...|
Yeast   425 RF------------------PPQTTYPPKNKNPTVYSNGLIPNSSTSSDNSTGKFKFPAMNGHDS 471

  Fly  1015 PSSKSSLKKAPFNFLHASNPNLVEFDFHTSKTLLPKMS--VGNTLDHGHNIQGFVTLKDLMLRKQ 1077
            .|.|::|..|....::..|         |.:: ||.:|  ..|...|..|....|          
Yeast   472 NSRKTTLTSATIPSINTVN---------TDES-LPAISNISSNATSHHPNRNSVV---------- 516

  Fly  1078 EEEAQEMYNNRVHLGVEKHKHARTESTAS-------------QQSAMSSSVTKPLEKLPKIQSVS 1129
                   |||          |.||||.:|             .:|:.....||...|..:....|
Yeast   517 -------YNN----------HKRTESGSSFVDLFNRISMLSPVKSSFDEEETKQPSKASRAVFDS 564

  Fly  1130 LPKTPDYEIS--------------------FKPDDESIKRTRTKEGQKLRDFGYELICGDEPSTS 1174
            ..:...|..|                    |....:|...:.||:...:          |....:
Yeast   565 ARRKSSYGHSRDASLSEMKKHRRNSSILSFFSSKSQSNPTSPTKQTFTI----------DPAKMT 619

  Fly  1175 SISRQEHHHHHHHHQHHLQHVQQQQ-------------------QLQHQQT-------------- 1206
            |.||.:.:.:.|.......|.::..                   .|.|.:|              
Yeast   620 SHSRSQSNSYSHARSQSYSHSRKHSLVTSPLKTSLSPINSKSNIALAHSETPTSSNNKEAVSQPS 684

  Fly  1207 QQQHSSKAKHFLRSQQLQLSSFLHKNSSGGSGKSSGSGADQKKSKGK--SSGDRRFPFSKHSTGS 1269
            :.:|..|.||        .|...||||      ||..|:.::|||.|  ||....|..||....|
Yeast   685 EGKHKHKHKH--------KSKHKHKNS------SSKDGSSEEKSKKKLFSSTKESFVGSKEFKRS 735

  Fly  1270 AGSGCGPGHAMTMTLPLNKKSKSNHALDGAVGNGVTIIGSGSSIKKSQT--YNQDLRDKIVGTKY 1332
            ...             |.:||..:             |...|:.||.||  :.:.:|        
Yeast   736 PSE-------------LTQKSTKS-------------ILPRSNAKKQQTSAFTEGIR-------- 766

  Fly  1333 DAHRKNSAPIPIFSKLSISGGTPAKPSKENRFLGSPLLHRT---LFGHHHHQQQ---------AV 1385
            ....|.|......|......||.|..:.:.||.   .||.|   .|.:.:.:::         .|
Yeast   767 SITAKESMQTADCSGWMSKKGTGAMGTWKQRFF---TLHGTRLSYFTNTNDEKERGLIDITAHRV 828

  Fly  1386 TPPSSADPDCDQEIFSQITLPTHNQAGYRSYRGPGILTTSTTNLCSSEGLQPPLPPA------PP 1444
            .|.|..|        ..|:|       |.:..|.|       ..|..  |.||.|.:      ..
Yeast   829 LPASDDD--------RLISL-------YAASLGKG-------KYCFK--LVPPQPGSKKGLTFTE 869

  Fly  1445 PPVNTSRQREEEQAEATISE-CAATPKVSSSGSVDSKAATPDYPNMECPPVFEPEIYSLSDTSLS 1508
            |.|:......:.:.:|.:|. ..||..:.:|..|.|..|||..|            .|.:.|.|.
Yeast   870 PRVHYFAVENKSEMKAWLSAIIKATIDIDTSVPVISSYATPTIP------------LSKAQTLLE 922

  Fly  1509 RIVMRTPSSSGATSATASTTTTNNNNNNNNTN 1540
            ...::|................::..|..|:|
Yeast   923 EARLQTQLRDAEEEEGRDQFGWDDTQNKRNSN 954

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594 11/42 (26%)
PH_CNK_insect-like 720..810 CDD:270135 9/38 (24%)
BOI1NP_009468.1 SH3_BOI 17..71 CDD:212819
SAM_superfamily 226..290 CDD:326639 3/18 (17%)
PH_Boi 778..894 CDD:270126 29/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.