DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Tex16

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_017174133.1 Gene:Tex16 MGIID:1890545 Length:1631 Species:Mus musculus

Alignment Length:1786 Identity:339/1787 (19%)
Similarity:573/1787 (32%) Gaps:587/1787 (33%)


  Fly    10 TPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRNF 74
            :|.:|..|::.||.|...|...|...||.|..||||...:|.:||::|..||:|:|:||..:|  
Mouse    17 SPTEVRMWVEDLDYSFLSYGEIFESAEINGERLLNITRKQLIDLGIVRTDHQDILLQAVARIR-- 79

  Fly    75 HYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILHDITRTIATL------KPLVGSL 133
                |....:..|:.  ...:|:.:...|...||.:::    |.|.|.:.|:      :.|.|::
Mouse    80 ----KKGKAEEQAMR--REDQNIKKMPTRFGKESEQLE----HAIDRVLFTISERRLARSLHGTI 134

  Fly   134 ERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDISDPMV 198
            |..|.           ::|...|:|..||......|:..|.  .......:|.|.:|        
Mouse   135 EHPPH-----------SILTATLDLVNIASTILNILERPPF--DCMSEFSSLKNHLI-------- 178

  Fly   199 LQPASLNLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINYQTVVGWQ 263
                  |.:||.|..||                                                
Mouse   179 ------NHITLLKHFSE------------------------------------------------ 189

  Fly   264 HRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMPSPRAAF-LTL 327
             ::.|.|..|:  |::...|   ..|||...|...|..||..:|.:......:..|||... :|.
Mouse   190 -QSDLTHENES--DIIDMCK---GVTKMCHYIISLPPDLPKPERQIPRPAHREDRSPRVQVPITT 248

  Fly   328 DTEQLATGGTGSAVPDPS-KSLSSE-KREVLTKANPV-------SSASDSDSSCSDIPTPTDPKL 383
            :.|::::.....|...|| :.||.. ....|:...||       ...|:|.||...:..|:|...
Mouse   249 EPERVSSSVKRKADNTPSIQHLSMPMTTSALSYGPPVQYTSVQNQRLSESYSSSPRVEFPSDEGA 313

  Fly   384 AAREIRLYYPKPRALLQRRN---TICGCEY------LSLKNSDL-VVPSWHERKPGIGSPTNCDP 438
            ...|....| |....:|..:   |:.|..|      |:|..||. ::.|..|:         |..
Mouse   314 FTLECDKGY-KSETEIQYTDAFETLGGSFYYKTLQDLTLIESDTPLMDSGSEK---------CVI 368

  Fly   439 GSPSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQRE-FLVDRYK 502
            .|.|  |:.:...:.||..::.:..:.:..|:.::|:.|           ..||::. |..:.|:
Mouse   369 DSDS--DRGVVSDFELEEQSKDSGSVTLGLDSDSEKSPR-----------DSDSRKHLFKAEPYQ 420

  Fly   503 PGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTENAEELLEA 567
            .....|      || :.|..|.:..:|...:|:.....:...|.|.:||      ..|::.|.::
Mouse   421 LDSVSV------ED-LTKTGKHLLRIEQYQMESGALKHWMTSGSEKSLE------DSNSQRLSDS 472

  Fly   568 INLATKGQDLPLAEAINMPLLQQGRRGRLD----------KSHSTPAYDNSGEESDTPPAIEPRK 622
            .|...|.::..:|.| ::..|.:..:.:::          :|:|..::...|.            
Mouse   473 DNERQKEENFQMASA-SVQSLMESEKTKMESESLWMISDSESYSVDSHTEKGR------------ 524

  Fly   623 EFLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELH 687
                                                  :|::.|::       ..:|.:|     
Mouse   525 --------------------------------------ASVSKINL-------IQIDETE----- 539

  Fly   688 TPSKSRTLTLKKKHSLM---AKRRNTNLKLLGTGDIQGHLYRRKKNHRGVTYWARIYFVMLDTIL 749
               |.||     |..||   ::..||:      .|.:|         ..:...|..||:...|. 
Mouse   540 ---KPRT-----KRYLMESDSEPSNTD------SDSEG---------CELASAAVKYFIATKTF- 580

  Fly   750 YGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHA----------FKVYHTAKSF-----YFAAES 799
                 :||:::|.   .|..:.|.::.::|...:          .|...|.||.     ..||..
Mouse   581 -----QQSSASSQ---FPKDSWSASRTINSDSESPVMSSDSMKYMKKAETCKSTCNLERLKAAHK 637

  Fly   800 LDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSEN----DSSGEECDALVIQNLSTPSPQGNK 860
            .::|..|:|..|                  |.|.|:|    ||||:...:.::...|....||:.
Mouse   638 SESLQDWLDAKR------------------KQLDSDNAGYWDSSGKYQFSSIVPQESVGKRQGDL 684

  Fly   861 ESMSMS---MTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQ-------- 914
            ::...|   ..:...:....|...:||...|...| ....|:.....:....:..|:        
Mouse   685 QTFQHSTEKKEVGSSSDKHQAQFGNERDQSDPKSK-RYLIKTETGLDNEGFQMDEEREGCLVESD 748

  Fly   915 YRSYRKVPGGSFGIQIGA-----NTPGYHDPAMPPTQIPPLVGPK-------------------L 955
            :|...:........::||     ..||:..|.:.|   |.|...|                   |
Mouse   749 FRDSEREAHLLEAHRLGARKKENRPPGFWRPIILP---PKLAQDKKTEEQKSVQQKDNRVSRIQL 810

  Fly   956 SRSSSRSSVVSGTESAVSLSASILG------------PPASPAPT-------------------- 988
            :|..|....|...|::.|||...|.            .|.||..|                    
Mouse   811 TRYKSEDKNVRFEEASSSLSDKPLSQEKLKKKHSYSFSPDSPTFTDEKHHRKASLKISGYKRQCK 875

  Fly   989 ----------------PTPTATPTSLQHQSS-EESPSQSQSQSPSSKSSLKKAPFN--------- 1027
                            |.|.::.|...:.|| .:||:....:|.:.|.|.:...::         
Mouse   876 EYRYPHSCESLKYQISPIPLSSETCTSNVSSFVDSPTSKSPKSVTRKKSRRSITYSPEQGSQKCT 940

  Fly  1028 --FLHASNPN----LVEFDFHTSKTLLPKMSVGNTLDH------GHNIQGFVTLKDLMLRKQEEE 1080
              |:..||.:    |:..|...|.:.|.    |....|      ...|:.|.|.::..| .|..:
Mouse   941 RCFMEISNSSYHKCLINSDDSDSDSPLH----GQISSHSKYSLRSKTIRHFKTSRNRPL-SQSLD 1000

  Fly  1081 AQEMYNNRVHLGVEKHKHA-------RTESTASQQSAMSSSVTKPLEKLPK-------------- 1124
            .|....:|..|..|..||:       ..||.||.|:...||||..:.|..|              
Mouse  1001 PQHSVVSRCSLHREDSKHSIDSTSYLHCESCASLQNLKGSSVTHTISKTTKKIMGQHSTHGHISG 1065

  Fly  1125 ----IQSVS---LPKTPDYEISFKPDDESIKRTRTKEGQKL--RDFGYELICGDEPSTSSISRQE 1180
                .||.|   |...|..|.:....|.:||.....|.:.|  .|..:|    ||.:|...:..|
Mouse  1066 PVRLSQSESKFNLTAQPQNEDTPDVSDRNIKAEANVEDKLLYKDDTDHE----DETNTEDETDGE 1126

  Fly  1181 HHHHHHHHQHHLQHVQQQQQLQHQQTQQQHSSKAKHFLRSQQLQLSSFLHKNSSGGSGKSSGSGA 1245
                                 ....|:.:.....                |:......||...|:
Mouse  1127 ---------------------DETDTEDEDEDDT----------------KDKKDPKDKSDPDGS 1154

  Fly  1246 DQKKSKGKSSGDRRFPFSKHSTGSAGSGCGP-----GHAMTMTLPLNKKSKSNHALDGAVGNGVT 1305
            |.|....:::.|..  .....:||:|...||     |.:..:|   :.||:|:..:|.|..:.|.
Mouse  1155 DPKDGNSENNTDSN--NGSQPSGSSGPTGGPDSSNDGDSKNVT---DHKSESDPTIDNATNSDVN 1214

  Fly  1306 IIGSGSSIKKSQTYNQDLRDKIVGTKYDAHRKNSAPIPIFSKLSISGGT-PAKPSKENRFLGSPL 1369
            :   ..|..::.|.|.|....:  .:|..|..|:         ...|.| ||..:|.        
Mouse  1215 L---KYSTDETCTNNLDNASDL--AEYFNHHNNA---------DFKGRTNPASGNKT-------- 1257

  Fly  1370 LHRTLFGHHHHQQQAVTPPSSADPDCDQEIFSQITLPTHNQAGYRSYRGPGILTTSTTNLCSSEG 1434
              ||:..:........|.|.:             |:.....|...:.|   :|:.|..|.....|
Mouse  1258 --RTILDYISGSNNEDTGPRN-------------TMIKEKIAYSENIR---LLSNSYQNNVIKNG 1304

  Fly  1435 LQPPLPPAPPPPVNTSRQREEEQAEATISECAAT---------PKVSSSGSVDSKAATPDYPNME 1490
            .:   |.:.|.|.|:....::..:.:.|:...||         .|.:|:......||...|.::.
Mouse  1305 SE---PSSNPSPQNSYGLPKDLDSNSNINPSNATNNTVNPNYGAKSTSTAIYKKTAALNYYSDIN 1366

  Fly  1491 CPPVFEPEI------------------------YSLSDTSLSRIVMRTPS--SSGATSATASTTT 1529
            ....|..|:                        ::::....:.::..|.:  |..|:..|:...|
Mouse  1367 DVTGFTYEVRSSFVVNSNYFDRKKYAGRLSFALHTINAIDTNNVITCTSAVRSKFASEKTSVLDT 1431

  Fly  1530 TNNN------------NNNNNTNNNTNTNSS 1548
            .::.            :.|.||.|:.|.|.|
Mouse  1432 KHSPRFSRFRSFNVIISPNYNTKNSQNANKS 1462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 26/64 (41%)
SAM 7..74 CDD:197735 26/64 (41%)
CRIC_ras_sig 82..165 CDD:287501 18/89 (20%)
PDZ_signaling 206..283 CDD:238492 9/77 (12%)
PH 720..814 CDD:278594 21/109 (19%)
PH_CNK_insect-like 720..810 CDD:270135 20/105 (19%)
Tex16XP_017174133.1 SAM 17..80 CDD:197735 26/69 (38%)
SAM_superfamily 17..79 CDD:301707 25/62 (40%)
CRIC_ras_sig 120..178 CDD:287501 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.