DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and ipcef1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_021324199.1 Gene:ipcef1 ZFINID:ZDB-GENE-060929-172 Length:407 Species:Danio rerio

Alignment Length:459 Identity:111/460 (24%)
Similarity:163/460 (35%) Gaps:160/460 (35%)


  Fly   707 RRNTNLKLLGTGDIQGHLYRRKKNHRGVT--YWARIYFVMLDTILYGFRSKQSTSASLVIFLPGF 769
            ||..::|.||.||.||.||:||:: :|:.  .|.:.:||:....||.:.|..:..|...|.|..|
Zfish    64 RRRVSVKDLGQGDCQGWLYKRKES-KGLLGWKWKKFWFVLKKCSLYWYTSDMAEKAEGYINLRDF 127

  Fly   770 TVSLAKEVHSKPHAFKVYHT-AKSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLY 833
            |:..|.|. .|..|.|..|. ..:.||||||:..:|:|:..|.|||.:..|:..:.|     :.|
Zfish   128 TIEQATEC-KKKFAMKASHLHVLTLYFAAESMKDMNKWLAKLTQASNEPEPTDSTNG-----ECY 186

  Fly   834 SENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFK 898
            || :|..|:.:.:.::.:...:|.          :|.|..||                      .
Zfish   187 SE-ESDDEDDEEMCVEYMDQLTPG----------SLHGCLPP----------------------P 218

  Fly   899 SSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHDPAMPPTQIPPLVGPKLSRSSSRSS 963
            .|::.|..|                                       :.|||          ||
Zfish   219 RSSSSPFQD---------------------------------------VIPLV----------SS 234

  Fly   964 VVSGTESAVSLSASILGPPASPAPTPTPTATPTSLQHQSSEESPSQSQSQ-----SPSSKS---- 1019
            |.|.||                    |.:|...|.|..||||.|.....|     .|:|..    
Zfish   235 VCSRTE--------------------TQSADSESWQEISSEEDPILKIQQCKGNDGPASDEMEML 279

  Fly  1020 --SLKKAPFNFLHASNPNLVEFDFHTSKTLLPKMSVGNTLDHGHNIQGF---VTLKDLMLRKQEE 1079
              .||:|..:...|..| ..:.||.:|  .:.:....|..|..|.|:..   :..|:..|:..|:
Zfish   280 YLHLKEASLSPTGALQP-FTKRDFRSS--FIRRCKDENINDKLHLIRALNSTLKAKEADLQAIEQ 341

  Fly  1080 EAQEMYNNR--------------VHLGVEKHKHARTESTASQQSAMSSSVTKPL-EKLPKIQSVS 1129
            ...|...||              ..:| ||||               |.|.||: :..|:.||:.
Zfish   342 VLSEPSLNRSKYRQWRDANVLLLQEIG-EKHK---------------SDVEKPMVQTRPQRQSLY 390

  Fly  1130 LPKT 1133
            .|.|
Zfish   391 GPNT 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594 35/97 (36%)
PH_CNK_insect-like 720..810 CDD:270135 32/93 (34%)
ipcef1XP_021324199.1 PH_CNK_mammalian-like 63..176 CDD:269962 43/114 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61890038
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12844
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.