DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and 4933403O08Rik

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_011246010.1 Gene:4933403O08Rik MGIID:1918280 Length:813 Species:Mus musculus

Alignment Length:803 Identity:161/804 (20%)
Similarity:250/804 (31%) Gaps:319/804 (40%)


  Fly   570 LATKGQDLPLAEAINMPLL--QQGRRGRLDKSH-STPAYDNSGEESDTPPAIEPRKEFLLVTP-- 629
            :..:..::|:..:...|..  :.||..|.::.: :.||.|.         |:.| ::.|.|.|  
Mouse     4 ITRRSSEVPVWRSAEAPTWGPEGGRPARFERGYAANPAKDF---------AVRP-EQGLTVIPAR 58

  Fly   630 -----PAPPPRPRKQRE--------MTPPAVPPPPPKPASMQPASSITSISIP------------ 669
                 ||.....|..||        .|.....|....|.|....||...|::.            
Mouse    59 GRSLSPARGYTDRYGRERAVSLARGYTERQASPRTLSPFSTHAVSSAQKITLQAARRPPMRHEEE 123

  Fly   670 --VPVPVPAAVDPSEISELHTPSKSRTLTL-----------------KKKHSLMAKRRNTNLKL- 714
              |...:...|.|:|..:..|...:|..|.                 :.:.||:....|..:|. 
Mouse   124 FLVGAAMGLTVKPAEGYDNETSQSARLYTQNIYDDDNDDEDDDDDVDENESSLIMNFINCFMKAK 188

  Fly   715 --------------------------------------LGTGDIQGHLYRRKKNHRGVTY--WAR 739
                                                  ||.|..:|.|: .|:..||::.  |.:
Mouse   189 AQNWIDCSWFRRLLPTFFSEEDRHSWPKNRFCAIACTELGHGKCEGWLW-HKRPSRGISLFSWKK 252

  Fly   740 IYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYHT-AKSFYFAAESLDAL 803
            .:|::..:.||.|.....|.|...|:||.|.:.||.... :.|||:..|. .|.||||...||.:
Mouse   253 YWFILKHSTLYWFSHLNDTKADGFIYLPEFRIDLAPHCR-RDHAFQATHARIKDFYFAGTCLDEM 316

  Fly   804 NQWV---------------------------------------------DFLRQAS--LKVPPST 821
            |.||                                             |:.::|:  :.|.|:.
Mouse   317 NYWVCQTIKLAFGSSFGDTAANAEYRLASTSVYAKCLVALKRNFPVIWCDYCQEATTIVSVNPNF 381

  Fly   822 GSKGGGDAKDLY----------SENDSSGEECDALVIQNLS----TPSPQG--NKESMSMSMTLS 870
            ..:...:..|.:          .|.|...::      |||:    .|:|:|  .::...|:..:.
Mouse   382 QYRRTQNISDEFIYFRPINAENRERDRKQKQ------QNLTLVTQQPTPEGIHQRDLGLMNQVVI 440

  Fly   871 GGTPPSSAPIKHERGYLDSFRKFTNTFKSSA-AKPSSD-------IPVPTEQYRSYRKVP----- 922
            ..|||                 .|...:|:| .||.:.       ||:      .|..||     
Mouse   441 ATTPP-----------------LTKELESTALVKPKTSGLLRIEKIPI------KYLWVPEFQRL 482

  Fly   923 -----------GGSFGIQIGANTPGYHDPAMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSLSA 976
                       |....|.: |..||..:  :..|:||.|                .....|.|.|
Mouse   483 EVTGIASPEERGKGTAILV-AGVPGKEE--LDDTEIPTL----------------HFTGFVHLEA 528

  Fly   977 SILGPPASPAPTPTPTATPTSLQHQSSE--ESPSQ-----SQSQSP--------SSKSSLKKAPF 1026
            .|  ...||:...:...||.:|..:|.|  |||..     ::|..|        .|.:.|.:||.
Mouse   529 LI--NKCSPSSEYSRPGTPGNLWMESPENAESPGSDDMEVARSMYPFRERSIFRRSWAELLEAPL 591

  Fly  1027 NFLHASNPNLVEFDFHTSKTLLPKMSVGNTLDHGHNIQGFVTLKDLMLRK---QEEEAQEMYNNR 1088
            |          ....|..:|           :|.||.:.    :|:...|   |||      |..
Mouse   592 N----------SEGLHIIQT-----------EHIHNEEN----RDMGCNKLTLQEE------NQV 625

  Fly  1089 VHLGVEKHKHARTESTASQQSAMSSSVTKPLEKLPKIQSVSLPK----------TPDY-----EI 1138
            :.|..::|..|       .|........:|  ||.:.:|.|||:          ||::     |.
Mouse   626 IPLPKDQHFQA-------LQGPFPLLPERP--KLQRQRSRSLPRNSEVGGQYLNTPEFKGSAEET 681

  Fly  1139 SFKPDD------ESIKRTRTKEG 1155
            .|.|.|      |:||...:.||
Mouse   682 PFFPRDHNLLTEENIKERHSMEG 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594 34/142 (24%)
PH_CNK_insect-like 720..810 CDD:270135 33/138 (24%)
4933403O08RikXP_011246010.1 PH-like 222..320 CDD:302622 34/100 (34%)
PH 231..327 CDD:278594 32/98 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61845704
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.