DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Cnksr2

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001106837.1 Gene:Cnksr2 RGDID:708454 Length:1032 Species:Rattus norvegicus

Alignment Length:1290 Identity:297/1291 (23%)
Similarity:482/1291 (37%) Gaps:368/1291 (29%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :::|:|.||.||:||||:.::.|:..|.:::|.|..||.|...|||:||:.||||||::||||:.
  Rat     8 VSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAVDL 72

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA----RNHAE---STKIDTRILHDITRTIATLKP 128
            |...:|.|:.:||:.::..:..:||||...:.    ..|.:   |.|:....|..:...|...|.
  Rat    73 LCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKS 137

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDI 193
            |:..|:|:||.....|.....||::..|||.||..:|....:....|....:.|..:.:.:|...
  Rat   138 LLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISLS 202

  Fly   194 SDPMVLQPASLNLVTLK--KRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINY 256
            |||:|.|.|.|.::.|.  |....||..|:|:|:|:|.:|....||||....||..|||::|:|:
  Rat   203 SDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDEVIQVNH 267

  Fly   257 QTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARW---AAQMP 318
            |||||||.:.::..|||....|:||:||||:....         ..|:..:||  ||   |.|..
  Rat   268 QTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLT---------SAPALLKNM--RWKPLALQPL 321

  Fly   319 SPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSC-SDI---PTPT 379
            .||:                     |:.|       |.|.::.:|:.:..|||. .|:   |.|.
  Rat   322 IPRS---------------------PTSS-------VATPSSTISTPTKRDSSALQDLYIPPPPA 358

  Fly   380 DPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPS-- 442
            :|         |.|:.    ::.|..|         .||       |...:|.|.:....||:  
  Rat   359 EP---------YIPRD----EKGNLPC---------EDL-------RGHMVGKPVHKGSESPNSF 394

  Fly   443 -----------IRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREF 496
                       :.:.::.:.|..|           .|.:|:...|.......||:.::...:..:
  Rat   395 LDQEYRKRFNIVEEDTVLYCYEYE-----------KGRSSSQGRRESTPTYGKLRPISMPVEYNW 448

  Fly   497 LVDRYKPGVSKVVRFDAKEDYV---MKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKT 558
            :.|...|  :|:.|...:|:.:   |.|||..                     ::.....||.|.
  Rat   449 VGDYEDP--NKMKRDSRRENSLLRYMSNEKIA---------------------QEEYMFQRNSKK 490

  Fly   559 ENAEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSHSTPAYDNSGEESDTPPAIEPRKE 623
            :..::..:..:.:|......|..::.|..|:|...|                             
  Rat   491 DTGKKSKKKGDKSTSPTHYSLLPSLQMDALRQDIMG----------------------------- 526

  Fly   624 FLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHT 688
                                                          .|||........:.|.|..
  Rat   527 ----------------------------------------------TPVPETTLYHTFQQSSLQH 545

  Fly   689 PSKSRTLTLKKKHSLMAK-RRNTNLKLLGTGDIQGHLYRRKKNHRGVTY----WARIYFVMLDTI 748
            .||.     |.|.::..| :|..:.|.||.||.:|.|:::|.   ..:|    |.:.:||:.|..
  Rat   546 KSKK-----KNKGAIAGKSKRRISCKDLGRGDCEGWLWKKKD---AKSYFSQKWKKYWFVLKDAS 602

  Fly   749 LYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDFLRQ 812
            ||.:.:::...|...|.||.|.:..|.|...| :|||..| ..||||||||.||.:|:|::.:..
  Rat   603 LYWYINEEDEKAEGFISLPEFKIDRASECRKK-YAFKACHPKIKSFYFAAEHLDDMNRWLNRINM 666

  Fly   813 ASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLS------- 870
            .:.........|   ..:|.:||:|.  ||.|........:|.|..:......||:.:       
  Rat   667 LTAGYAERERIK---QEQDYWSESDK--EEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAK 726

  Fly   871 ----GGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYR---KVPGGSFGI 928
                ..|..|.:...||     .||:  ....|||..|   |.....|.||::   :.|..|.|:
  Rat   727 HSRLSSTETSQSQSSHE-----EFRQ--EVTGSSAVSP---IRKTASQRRSWQDLIETPLTSSGL 781

  Fly   929 QI--------------GANTPGYHDPAMPPTQ---IPPLVGPKLSRSSSRSSVVSGTESA----- 971
            ..              .|.:|.:...:..|||   :....||.....|.|..|::|....     
  Rat   782 HYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGGKPRSFT 846

  Fly   972 ----VSLSASILGPPASPAPTPTPTATPTSLQHQSSEESPSQSQSQSPSSKSSLKKAPFNFLHAS 1032
                ...:...|..|.| |..|.....|..::.:..||..                      .|:
  Rat   847 LPRDSGFNHCCLNAPVS-ACDPQDDIQPPEVEEEEEEEEE----------------------EAA 888

  Fly  1033 NPNLVEFDFHTSKTLLPKMSVGNTLDHGHNIQGFVTLKDLMLRKQEEEAQEMYNNRVHLGVEKHK 1097
            ..|:.|.:.:..:.|      |:            :|:||....:|.....:..:|:...:|   
  Rat   889 GENIGEKNENREEKL------GD------------SLQDLYRALEEASLSPLGEHRISTKIE--- 932

  Fly  1098 HARTESTASQQSAMSSSVTKPL--EKLPKIQSV-SLPKTPDYEISF------KPDDESIKRTRTK 1153
                     .:.:.......|:  |||.:::.: |..|..:.|::.      .||      ..:|
  Rat   933 ---------YKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPD------LTSK 982

  Fly  1154 EGQKLRDFGYEL---ICGDEPS-------------TSSISRQEHHHHHHHHQHHL 1192
            |.|:.:....:|   ||.:..|             |||::     |.|.:.:.|:
  Rat   983 EFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVITSSLT-----HTHSYIETHV 1032

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 33/68 (49%)
SAM 7..74 CDD:197735 33/67 (49%)
CRIC_ras_sig 82..165 CDD:287501 25/90 (28%)
PDZ_signaling 206..283 CDD:238492 34/79 (43%)
PH 720..814 CDD:278594 34/99 (34%)
PH_CNK_insect-like 720..810 CDD:270135 34/95 (36%)
Cnksr2NP_001106837.1 SAM_CNK1,2,3-suppressor 8..76 CDD:188910 33/68 (49%)
SAM 8..73 CDD:197735 32/65 (49%)
CRIC_ras_sig 84..176 CDD:287501 26/92 (28%)
Peptidase_C98 139..>218 CDD:292138 23/79 (29%)
PDZ_signaling 222..294 CDD:238492 33/72 (46%)
DUF1170 341..561 CDD:284152 53/363 (15%)
PH_CNK_mammalian-like 559..672 CDD:269962 40/117 (34%)
PH 573..669 CDD:278594 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61947073
eggNOG 1 0.900 E1_KOG1738
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I2901
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T618174
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.