DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and si:ch211-26b3.4

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_021327272.1 Gene:si:ch211-26b3.4 ZFINID:ZDB-GENE-081104-60 Length:1031 Species:Danio rerio

Alignment Length:1277 Identity:307/1278 (24%)
Similarity:474/1278 (37%) Gaps:392/1278 (31%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            |::|:|.||.||:||||:.:..|:..|.:::|.|..||:|...|||.||:.||||||::||||:.
Zfish     8 ISKWSPKQVLDWMKGLDDCLLQYMRTFEREQITGEQLLHITHQELEELGVTRIGHQELILEAVDL 72

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA---RNHAESTKIDTRILHDITRTIATL----KP 128
            |...:|.|:.:||:.::..:..:||||...:.   |......::..|:.:|...::..|    |.
Zfish    73 LCALNYGLETENLRTLSHKLNASAKNLQNFITGRRRGGHYDGRVSRRLPNDFLTSVVDLIGAAKN 137

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDI 193
            |:..|:|:||.....|.....|:::..|||.||..:|....:....|....:.|..:...:|...
Zfish   138 LLAWLDRSPFVSVSEYSVLKNNIVQLCLELTTIVQQDCTVYETENKILHVCKTLSGICEHIISLS 202

  Fly   194 SDPMVLQPASLNLVTLKK-RESE-LGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINY 256
            ||.:|.|.|.|.:|.|.. ..|| ||..|:|:|:|:|.:|....||||....||..|||::|:|:
Zfish   203 SDSLVSQSAHLEVVHLTNVMPSEGLGMYIKSTYDGLHVITGTTENSPADQCKKIHAGDEVIQVNH 267

  Fly   257 QTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMPSPR 321
            |||||||.:.::..|||....|:||:||||::|  .|.       .|:..:|  |||        
Zfish   268 QTVVGWQLKNLVNCLREDPSGVILTLKKRPQNT--LGS-------TPALLKN--ARW-------- 313

  Fly   322 AAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPTDPKLAAR 386
                                                  .|::....|.|.||..|||        
Zfish   314 --------------------------------------KPLALQPLSTSPCSGSPTP-------- 332

  Fly   387 EIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPSIRDKSISFG 451
                    |..|        |...||               ||:.:     ||...:...|..:|
Zfish   333 --------PSTL--------GSVGLS---------------PGVDT-----PGGHDVFILSPVYG 361

  Fly   452 YGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKED 516
            :..|...|..  .|:.|..|                               ||            
Zfish   362 HREEDLDRGG--FGVFGSDS-------------------------------PG------------ 381

  Fly   517 YVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTENAEELLEAINLATKGQDLPLAE 581
            |.::.|        .:...:.|:...:.|....|.  |..:|....:|.: :::.|:.    |||
Zfish   382 YYVEQE--------VLGGQYFPLLEEESGRNTGLR--RRDRTPTHSDLRQ-VSMGTEW----LAE 431

  Fly   582 AINMPLLQQGRRGRLDKSHSTPAYDNSG------EESDTPPAIEPRKEFLLVTPPAPPPRPRKQR 640
            .....:.::|.|   |...|...:.:..      ||::.......|:.......|:.|..|    
Zfish   432 PQESGVYKRGSR---DSDSSLLRFLSDDRILLIQEEAEFSQRDTSRRSRKKSRNPSSPSFP---- 489

  Fly   641 EMTPPAVPPP------PPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHTPSKS------- 692
             ::|..:.||      ||:             .:|.|||     |.:.:...|..:.:       
Zfish   490 -ISPSMLAPPVRLDTGPPE-------------GLPFPVP-----DSNTMPHYHRAADTLRADADR 535

  Fly   693 -----------------------RTLTLKK-KHSL-MAKRRNTNLKLLGTGDIQGHLYRRKKNHR 732
                                   ||...|| |.|| .|.||....|.||.||.:|.|: :||:..
Zfish   536 YASSGLDRQAGASMRKSVHYASLRTKPKKKSKGSLSSASRRRIACKDLGHGDCEGWLW-KKKDAT 599

  Fly   733 G--VTYWARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFY 794
            |  ...|.:.:||:.|:.||.:.::....|...|.||.|.:..|.|...| ||||..| ..|||:
Zfish   600 GYFTQKWKKYWFVLKDSNLYWYTNQNDEKAEGFISLPEFRIDRAIECRRK-HAFKACHPKIKSFF 663

  Fly   795 FAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDA-----KDLYSENDSSGEECDALVIQNLSTP 854
            ||.:.|:.:|:|::.|..|::...|.       |.     :|.:||:|.  :|.|.         
Zfish   664 FATDHLEEMNRWMNRLGLAAIGYTPD-------DPVPRPDEDYWSESDQ--DEVDG--------- 710

  Fly   855 SPQGNKESMSMSMTLS-------GGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPS-SDIPVP 911
                       ||||.       ..|..|::|.. ||.:...     :||..|:|:.| |.....
Zfish   711 -----------SMTLKQEATYHHNPTATSTSPFP-ERHFSSG-----STFSHSSAEESHSSCRSS 758

  Fly   912 TEQYRSYRKVPGGSFGIQIGANTPGYHDPAMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSLSA 976
            ..:.||::.:      |:....:.|.|.......:.|.|:.|...|.:             :|.|
Zfish   759 HRERRSWQDL------IETPLTSTGLHYLQTAEEEEPGLLSPDQLRQA-------------TLPA 804

  Fly   977 SILGPPASPAPTPTPTATPTSLQH----QSSEESPSQSQSQSPSSKSSLKKAPFNFLHASNPNLV 1037
            ....|.....|.|...:..:..:|    |.|:..|....:....|..|.:.              
Zfish   805 QRRRPLERDGPFPLTDSEESRPRHHTHKQRSQSLPRHRDTHGGHSHRSTRT-------------- 855

  Fly  1038 EFDFHTSKTLLPKMSVGNTLDHGHNIQGFVTLKDLMLRKQEEEAQEMYNNRVHLGVEKHKHARTE 1102
              ..||..||.|:       .|.|                ||:.:|          |:.||.|..
Zfish   856 --HMHTHGTLRPR-------THLH----------------EEDEEE----------EEEKHVRKA 885

  Fly  1103 STASQQS-AMSSSVTKPLEKLPK-IQSVSL-------PKT-PDYEISF--KPDD----ESIKRTR 1151
            |:...:| ..:|..|..|::|.| ::..||       |.| .::..||  :.:|    |.:.|.|
Zfish   886 SSRRPESDEKASDGTDGLQELYKSLEQASLSAFGQQRPSTKQEFRRSFIKRSNDPATNERLHRIR 950

  Fly  1152 -------TKEGQKLRDFGYELICGDEPSTSSISRQEHHHHHH 1186
                   .|||    |........|:|..:|...:|....:|
Zfish   951 VLRSTLKAKEG----DLSIISQVLDDPCLTSRKFREWKQRNH 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 34/68 (50%)
SAM 7..74 CDD:197735 33/67 (49%)
CRIC_ras_sig 82..165 CDD:287501 23/90 (26%)
PDZ_signaling 206..283 CDD:238492 36/79 (46%)
PH 720..814 CDD:278594 34/97 (35%)
PH_CNK_insect-like 720..810 CDD:270135 32/93 (34%)
si:ch211-26b3.4XP_021327272.1 SAM_CNK1,2,3-suppressor 8..76 CDD:188910 34/68 (50%)
CRIC_ras_sig 84..176 CDD:313706 24/92 (26%)
PDZ_signaling 223..294 CDD:238492 34/71 (48%)
DUF1170 346..>479 CDD:310926 30/201 (15%)
PH_CNK_mammalian-like 575..686 CDD:269962 41/113 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61921974
eggNOG 1 0.900 E1_KOG1738
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I2969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T596824
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.