DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr2a

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_021326010.1 Gene:cnksr2a ZFINID:ZDB-GENE-060228-5 Length:1034 Species:Danio rerio

Alignment Length:1210 Identity:289/1211 (24%)
Similarity:445/1211 (37%) Gaps:394/1211 (33%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :::|:|.||.||:||||:.::.|:..|.::::||..||.|...|||:||:.||||||::||||:.
Zfish     8 VSKWSPSQVVDWMKGLDDCLQQYIKNFEREKVGGDQLLRITHQELEDLGVSRIGHQELILEAVDL 72

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA----RNHAE---STKIDTRILHDITRTIATLKP 128
            |...:|.|:.:||:.::..:..:||||...:.    ..|.:   :.|:....|..:...||..|.
Zfish    73 LCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTTRKLPNDFLTSVVDLIAAAKS 137

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDI 193
            |:..|:|:||.....|.....||::..|||.||..:|....:....|....:.|..:.:.:|...
Zfish   138 LLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISLS 202

  Fly   194 SDPMVLQPASLNLVTLK--KRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINY 256
            |||:|.|.|.|.:|.|.  |....||..|:|:|:|:|.:|.....|||....||..|||::|:|:
Zfish   203 SDPLVSQSAHLEVVQLANIKPTEGLGMYIKSTYDGLHVITGTTEGSPADRCKKIHAGDEVIQVNH 267

  Fly   257 QTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARW---AAQMP 318
            |||||||.:.::..||.....|.||:||||:.|..         ..|:..:||  ||   |.|.|
Zfish   268 QTVVGWQLKNLVSSLRGDPAGVTLTLKKRPQSTLT---------SAPALLKNM--RWKPLALQQP 321

  Fly   319 SPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSC-SDI---PTPT 379
                                 .||....|.|:      |..:.:|:.|..|||. .|:   |.|:
Zfish   322 ---------------------VVPRSPTSSSA------TPTSTISTPSKRDSSALQDLYIPPPPS 359

  Fly   380 DPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNC-------D 437
            :|         |.|.......||                      :.|.||.|.:..       .
Zfish   360 EP---------YTPSGIHTNVRR----------------------DEKGGIQSESGVPVAKGSES 393

  Fly   438 PGS----------PSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDS 492
            |.|          |.:.::::.:.|..:.:..|||            :||             ||
Zfish   394 PNSFLDQEYRRRFPLVEEEAVLYCYEYDPSHGPTT------------SRR-------------DS 433

  Fly   493 QREFLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCK 557
            ...:  .|.:| :|..|.::...||                             ||.....|:.:
Zfish   434 TPTY--GRLRP-ISMPVEYNWVPDY-----------------------------EDPARVKRDGR 466

  Fly   558 TENAEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSHSTPAYDNSGEESDTP------P 616
            .||:  ||..:: ..|..||    |........|:||:           ...|:|.:|      |
Zfish   467 RENS--LLRYVS-DEKAADL----AGRSMKRDTGKRGK-----------KKSEKSGSPTHYSLLP 513

  Fly   617 AIEPRKEFLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPS 681
            .::  .|.|            :|..|..|                                 :|.
Zfish   514 TLQ--MEVL------------RQESMNTP---------------------------------NPD 531

  Fly   682 EISELHTPSKSRTLTLKKKHSLMA-----KRRNTNLKLLGTGDIQGHLYRRKKNHRGVTY----W 737
            ..|..||...|..|:..||.|..|     .:|..:.|.||.||.:|.|:::|.   ..:|    |
Zfish   532 STSLYHTFQGSSLLSKTKKKSKAAPLSSISKRRISCKDLGRGDCEGWLWKKKD---AKSYFSQKW 593

  Fly   738 ARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLD 801
            .:.:||:.|..||.:.:::...|...:.||.|.:..|.|...| :|||..| ..|||||||:.:|
Zfish   594 KKYWFVLKDACLYWYMNEEDEKAEGFVSLPEFKIDRASECRKK-YAFKACHPKIKSFYFAADGVD 657

  Fly   802 ALNQWVDFLRQASLKVPPSTGSKGGGDAK---------DLYSENDSSGEECDALVIQNLSTPSPQ 857
            .:|:|:..|..|:           .|.|:         |.:||:|....|          |||  
Zfish   658 DMNRWLSRLNMAA-----------AGYAERERIRQEHADYWSESDHEDNE----------TPS-- 699

  Fly   858 GNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYRKVP 922
                           ||...:|                             |.|.:.|       
Zfish   700 ---------------TPKQDSP-----------------------------PPPYDTY------- 713

  Fly   923 GGSFGIQIGANTPGYHDPAMPPTQI---PPLVGPKLSR------SSSRSSVVSGTESAVSLSASI 978
                             |..|..|:   .|.:.||..|      |.||||...........|:|.
Zfish   714 -----------------PRPPSNQVSCASPYLEPKHGRLSSTETSQSRSSHEEYRSEPQGGSSSG 761

  Fly   979 LGPPASPA-----------PTPTPTATPTSLQHQSSEE----------SPS-QSQSQSPSSKSSL 1021
            .|.||..:           .||..::....||....|:          ||. :.||..|:.::.:
Zfish   762 GGSPARKSASQRRSWQDLIETPLTSSGLHYLQTLPLEDAVFCEPGAGLSPEYRRQSTLPAQRTLM 826

  Fly  1022 KK--APFNFLHASNPNLVEFDFHTSKTLLPKMSVGN----TLDHGHNIQGFVTLKDLMLRKQEEE 1080
            :.  .||..|..            .:...|..:||.    ||.....:...:|....|..:::..
Zfish   827 QDHYGPFPMLQG------------ERLRDPVNAVGKPRSFTLPRDSGLHALLTPSASMADQRDPN 879

  Fly  1081 AQEM-YNNRVHLGVEKHKHARTESTASQQSAMSSSVTKPL 1119
            .:|: .:.|::.|.|:....:|:|......|:..:...|:
Zfish   880 RRELSRSQRINNGGEQDYQGQTDSLGDLYRALERARLTPI 919

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 33/68 (49%)
SAM 7..74 CDD:197735 33/67 (49%)
CRIC_ras_sig 82..165 CDD:287501 25/90 (28%)
PDZ_signaling 206..283 CDD:238492 33/79 (42%)
PH 720..814 CDD:278594 33/99 (33%)
PH_CNK_insect-like 720..810 CDD:270135 31/95 (33%)
cnksr2aXP_021326010.1 SAM_CNK1,2,3-suppressor 8..76 CDD:188910 33/68 (49%)
CRIC_ras_sig 84..176 CDD:313706 26/92 (28%)
PDZ 225..295 CDD:320768 31/70 (44%)
DUF1170 342..515 CDD:310926 51/279 (18%)
PH_CNK_mammalian-like 561..674 CDD:269962 40/128 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61939322
eggNOG 1 0.900 E1_KOG1738
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I2969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T596824
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3250
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.