DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr2b

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_009293705.1 Gene:cnksr2b ZFINID:ZDB-GENE-030131-8048 Length:969 Species:Danio rerio

Alignment Length:1175 Identity:279/1176 (24%)
Similarity:434/1176 (37%) Gaps:325/1176 (28%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            ::.|:..||.||:||||:.::.|:..|.::::||..||.|...|||:||:.||||||::||||:.
Zfish     8 VSRWSTSQVVDWMKGLDDCLQQYIKNFEQEKVGGEQLLRITHQELEDLGVSRIGHQELILEAVDL 72

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA----RNHAE---STKIDTRILHDITRTIATLKP 128
            |...:|.|:.:||:.:...:..:||||...:.    ..|.:   :.|:....|..:...||..|.
Zfish    73 LCALNYGLETENLKTLTHKLNASAKNLQNFITGRRRGGHYDGRATRKLPNDFLTSVVDLIAAAKS 137

  Fly   129 LVGSLE------RTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLAN 187
            |:..|:      |:||.....|.....||::..|||.||..:|....:....|....:.|..:.:
Zfish   138 LLAWLDRCYFFIRSPFAAVADYSMTRNNVIQLCLELTTIVQQDGTVYETENKILHVCKTLSGVCD 202

  Fly   188 FVIQDISDPMVLQPASLNLVTLKK-RESE-LGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDE 250
            .:|...|||||.|.|.|.:|.|.. |.:| ||..|:|:|:|:|.:|.....|.|....||..|||
Zfish   203 HIIALSSDPMVSQAAHLEVVQLDNIRSTEGLGMYIKSTYDGLHVITGTTEGSLADRCKKIHAGDE 267

  Fly   251 IVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARW-- 313
            ::|:|:|||||||.:.::..||.....|.||:||||:.|..         ..|:..:||  ||  
Zfish   268 VIQVNHQTVVGWQLKNLVNSLRSNPAGVTLTLKKRPQSTLT---------SAPALLKNM--RWKP 321

  Fly   314 -AAQ---MPSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSCS- 373
             |.|   .|||                 .|:|..||.:||:..|.               .||: 
Zfish   322 LALQPIIPPSP-----------------SSSVATPSSTLSTPSRR---------------DSCAL 354

  Fly   374 -DI---PTPTDPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPT 434
             |:   |.|.:|         |.|:...    .|....|:. :.|.||         .|......
Zfish   355 QDLYIPPPPDEP---------YTPRDDV----GNLTSNCQQ-AAKGSD---------SPNSFLDQ 396

  Fly   435 NCDPGSPSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREFLVD 499
            .|....|.:.:.::.:.|..:....|            ...||             ||...:  .
Zfish   397 ECRRRFPLLDEDAVLYCYEYDQTQGP------------PPVRR-------------DSTPTY--G 434

  Fly   500 RYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTENAEEL 564
            |.:| :|..|.::...||                             ||..:..:..:.||:   
Zfish   435 RLRP-ISMPVEYNWVGDY-----------------------------EDPAKLKKEIRRENS--- 466

  Fly   565 LEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSHSTPAYDNSGEESDTPPAIEPRKEFLLVTP 629
                          |...::....::...||.....|....:..|.     ||     .:.||  
Zfish   467 --------------LLRYVSEDKTEEFHTGRRSSRRSRRKSEKGGS-----PA-----HYALV-- 505

  Fly   630 PAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELH-TPSKSR 693
                  |..|.:|.||                  .|::.|.          ||.|.:: |..:|.
Zfish   506 ------PTLQMDMLPP------------------DSLATPT----------SETSSVYLTFDRSS 536

  Fly   694 TLTLKKKHSLMA------KRRNTNLKLLGTGDIQGHLYRRKKNHRGVTY----WARIYFVMLDTI 748
            .|:..||:.|.|      .:|..:.:.||.||.:|.|:::|.   ..:|    |.:.:.|:.|..
Zfish   537 VLSRSKKNKLRAGSLPSISKRRISCRDLGQGDCEGWLWKKKD---AKSYFSQKWKKYWVVLKDAC 598

  Fly   749 LYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDFLRQ 812
            ||.:.:::...|...:.||.|.:..|.|...| .|||..| ..|||||||::::.:|:|:..:..
Zfish   599 LYWYTNEEDEKAEGFVSLPEFNIDQASECRKK-FAFKACHPKIKSFYFAADNIEDMNRWLSLMNM 662

  Fly   813 ASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQNLSTPSPQG---NKESMSMSMTLSGGTP 874
            |:   ...:..|......|.:||:|....:..:...:..|.|.|..   :..|:|.........|
Zfish   663 AA---AAHSEQKRIRQDHDYWSESDHEDADHISSTTKQDSPPPPYDTYPHPTSVSPFQDSQHIRP 724

  Fly   875 PSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHD 939
            ||:..::       |....:.|...|.:..||.......|.||::.:      |:....:.|.|.
Zfish   725 PSTETVQ-------SRSPLSETQGGSVSSASSPGRKSASQRRSWQDL------IETPLTSSGLHF 776

  Fly   940 PAMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSLSASILGPPASPAPTP--TPTATPTSLQHQS 1002
                 .|..||        .....|.|.....|.|......|.....||.  .|..|||      
Zfish   777 -----LQTLPL--------DDSVFVDSNRTVPVELRRQSTLPAQHGLPTEHFIPPTTPT------ 822

  Fly  1003 SEESPSQSQSQSPSSKSSLKKAPFNFLHASNPNLVEFDFHTSKTLLPKMSVGNTLDHG-----HN 1062
                       .||.|.                            :|.:..|.|:|.|     | 
Zfish   823 -----------QPSPKP----------------------------IPALGRGETMDGGGIGSKH- 847

  Fly  1063 IQGFVTLKDLMLR--------KQEEEAQEMYNNRVH---LGVEKHKHARTESTASQQSAMSSSVT 1116
             :.|...:|..|.        .:..:||..:...||   .|.|:.:..:.:|......|:..|..
Zfish   848 -RSFTLPRDSGLHAILAASSAAEHGDAQRYHLGHVHSRDTGGERERRHQADSLVDLYRALERSSL 911

  Fly  1117 KPLEK 1121
            .|:.:
Zfish   912 SPVNE 916

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 32/68 (47%)
SAM 7..74 CDD:197735 32/67 (48%)
CRIC_ras_sig 82..165 CDD:287501 25/96 (26%)
PDZ_signaling 206..283 CDD:238492 33/79 (42%)
PH 720..814 CDD:278594 30/99 (30%)
PH_CNK_insect-like 720..810 CDD:270135 29/95 (31%)
cnksr2bXP_009293705.1 SAM_CNK1,2,3-suppressor 8..76 CDD:188910 32/68 (47%)
SAM 8..73 CDD:197735 31/65 (48%)
CRIC_ras_sig 84..182 CDD:287501 26/98 (27%)
PDZ_signaling 229..300 CDD:238492 30/71 (42%)
DUF1170 347..>475 CDD:284152 34/240 (14%)
PH_CNK_mammalian-like 555..667 CDD:269962 35/119 (29%)
PH 569..665 CDD:278594 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61939375
eggNOG 1 0.900 E1_KOG1738
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I2969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T596824
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.760

Return to query results.
Submit another query.