DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_009291361.1 Gene:cnksr1 ZFINID:ZDB-GENE-040426-1802 Length:790 Species:Danio rerio

Alignment Length:992 Identity:197/993 (20%)
Similarity:337/993 (34%) Gaps:318/993 (32%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :|.|:.::||:|:||||..::  .|.||:.::.|..||.:....|||:|:.:|||||::|||||.
Zfish     4 VASWSTERVTEWLKGLDAPLQ--QYPFSEWQLSGSDLLQLSSSRLENIGVHKIGHQELILEAVEK 66

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA------RNHAES-TKIDTRILHDITRTIATLKP 128
            |....|.:..|:|:.:...:...|..|...:.      .|.|:| |.:..::|..:...|.....
Zfish    67 LCALTYSVGGDSLRSLTEKLRAVAHTLQMSIQGRWRVNSNDAQSATNLPQQVLQAVVDVIIASNG 131

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGL--ELATIAHRDRFALQPVPAIRQSAERLENLANFVIQ 191
            ||..|.|..|.:|   ..|..||....|  :|.|..|::....:....|.....:|..:.:.::.
Zfish   132 LVSVLNRYQFEQQ---TGYTANVKVAALCKDLDTNVHKETAVFEKEKDIISICRQLVAVCDEILT 193

  Fly   192 DISDPMVLQPASLNLVTLKKRE--SELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQI 254
            ....|::.....|..|.|....  .::|..|.::.:..|.||.|....||....||.:|||::|:
Zfish   194 VSPLPLLTHTTQLESVDLVPASPGDQVGIEITTTGSRNHFVTGIPTEFPAEICEKILEGDEVIQV 258

  Fly   255 NYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMPS 319
            |.|.||||..:.:::.|.|....|.|.|:                 |||...:...:|..::...
Zfish   259 NGQIVVGWSRKNLVKKLEENPDGVTLVVR-----------------RLPGFLKRKESRAKSEREE 306

  Fly   320 PRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPTDPKLA 384
            |...                   :..||..|....|......:|.:.|.                
Zfish   307 PEEG-------------------EEEKSRHSLLGRVAASVRSLSFSEDI---------------- 336

  Fly   385 AREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPSIRDKSIS 449
                       ||||..|:               ...|.|..:                |:||  
Zfish   337 -----------RALLYLRS---------------ATDSTHHFR----------------REKS-- 357

  Fly   450 FGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREFLVDRYKPGVSKVVRFDAK 514
                           .:|.|.|:::     :::..||:|             :||          
Zfish   358 ---------------ALANDQSSNE-----YQSGTLKRL-------------QPG---------- 379

  Fly   515 EDYVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTENAEELLEAINLATKGQDLPL 579
                                                                             
Zfish   380 ----------------------------------------------------------------- 379

  Fly   580 AEAINMPLLQQGRRGRLDKSHSTPAYDNSGEESDTPPAIEPRKEFLLVTPPAPPPRPRKQREMTP 644
                                            :|:|.|                  .|...|:..
Zfish   380 --------------------------------TDSPRA------------------SRNSLEVKI 394

  Fly   645 PAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHTPSKSRTLTLKKKHSLMAKRRN 709
            .|...|.|:..:....||              ..|.:.:.|.....||.|   |...:.|::|| 
Zfish   395 SAERSPSPQELNRSSTSS--------------CPDMAGLREEKENKKSST---KGMRTAMSRRR- 441

  Fly   710 TNLKLLGTGDIQGHLYRRKKNHRGV---TYWARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTV 771
            .:.:.||..|..|.|::::| ..||   ..|.|.:||:....||.:.|:|...|..:|.:..:.:
Zfish   442 VSCRELGRPDCDGWLWKKRK-EAGVFMTQKWQRFWFVLKGPTLYWYNSQQEEKAEGLIKIGSYNI 505

  Fly   772 SLAKEVHSKPHAFKVYHTA-KSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSE 835
            ..|.| |.:.:.||:.|.. ::|:|||:::..:::|::.|..|..|......|:...: :|.|||
Zfish   506 ESAGE-HKRKYVFKMCHPRFQNFFFAADNVTDMSKWINCLITAIQKHKKYAQSQPDSE-EDCYSE 568

  Fly   836 NDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSS 900
            .:|..|          |:.||..:::.:.........|.|.: .:|..|     ..:.....:::
Zfish   569 TESEEE----------SSRSPLPHRKKLYTKTQTQSNTLPRT-KVKQNR-----MSEPITISQAT 617

  Fly   901 AAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHD---PAMPPTQIPPLVGPKLSRSSSRS 962
            .:|.:.::....|.:.|.:|  ||.  ..||...|..||   .:.......|::..|:....:..
Zfish   618 GSKIAGNVDEMDEMFNSIKK--GGV--TLIGQKQPMTHDQLRKSFIKRNKNPVINEKIHTLRALQ 678

  Fly   963 SVVSGTESAVSLSASIL 979
            |.:...|:.:.|...||
Zfish   679 STLKAKEAELHLINRIL 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 30/68 (44%)
SAM 7..74 CDD:197735 30/67 (45%)
CRIC_ras_sig 82..165 CDD:287501 22/92 (24%)
PDZ_signaling 206..283 CDD:238492 27/79 (34%)
PH 720..814 CDD:278594 28/98 (29%)
PH_CNK_insect-like 720..810 CDD:270135 26/94 (28%)
cnksr1XP_009291361.1 SAM_CNK1,2,3-suppressor 4..70 CDD:188910 30/68 (44%)
SAM 4..67 CDD:197735 29/65 (45%)
CRIC_ras_sig 78..168 CDD:287501 22/93 (24%)
PDZ_signaling 215..287 CDD:238492 25/72 (35%)
PH_CNK_mammalian-like 438..552 CDD:269962 34/117 (29%)
PH 452..548 CDD:278594 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62000262
eggNOG 1 0.900 E1_KOG1738
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I2969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12844
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.