DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Ipcef1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_017444823.1 Gene:Ipcef1 RGDID:735159 Length:439 Species:Rattus norvegicus

Alignment Length:461 Identity:111/462 (24%)
Similarity:178/462 (39%) Gaps:91/462 (20%)


  Fly   707 RRNTNLKLLGTGDIQGHLYRRKKNHRGV---TYWARIYFVMLDTILYGFRSKQSTSASLVIFLPG 768
            ||..:.|.||..|.||.||  ||..:|.   ..|.:.:.|:..:.||.:.::.:..|...:.||.
  Rat    32 RRRISCKDLGHADCQGWLY--KKKEKGTFLSNKWKKFWVVLKGSSLYWYGNQLAEKADGFVNLPD 94

  Fly   769 FTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDL 832
            |||..|.|. .|.:|||:.| ..|:||||||:|..:|.|::.|..|......:|..      ::.
  Rat    95 FTVERASEC-KKKNAFKINHPQIKTFYFAAENLQEMNMWLNKLGFAVTHKESTTKD------EEC 152

  Fly   833 YSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTF 897
            |||::....|   ..::  :.|.|..:..|..:....:.....||:|.:.|...  ||....||.
  Rat   153 YSESEQEDPE---TAVE--APPPPSASATSSPVVRVDAARRASSSSPKRRETSC--SFSSLENTV 210

  Fly   898 KSSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHDPAMP---PTQIPPLVGPKLS--R 957
            |:.:...||.    :::.:|:         :.|..::|...|...|   ..|:..|...:.|  |
  Rat   211 KAPSRFSSSG----SKERQSW---------LDIVNSSPATEDVGHPLSFAVQVHTLASSEASSCR 262

  Fly   958 SSSRSSVVSGTESAVSLSA---SILGPPASPAPTPTPTATPTSLQH---QSSEESPSQSQSQS-- 1014
            .|..||....:....|||:   |.|.........|...:.......   :|||:...:...:|  
  Rat   263 VSENSSTTPESGCLNSLSSDDTSSLNNSQDHLTVPDRASGSRMTDRDEIKSSEDDEMEKLYKSLE 327

  Fly  1015 -----------PSSKSSLKKAPFNFL-HASNPNLVEFDFHTSKTLLPKMSVGNTLDHGHNIQGFV 1067
                       ||:|..|:|   :|: ...||::.| ..|..:||      .:||          
  Rat   328 QASLSPLGDRRPSTKKELRK---SFVKRCKNPSINE-KLHKIRTL------NSTL---------- 372

  Fly  1068 TLKDLMLRKQEEEAQEMYNNRV---HLGVEKHKHARTESTASQQSAMSSSVTKPLEKLPKIQSVS 1129
                    |.:|....|.|..:   .|...|::..:..:|...|......|.:..|..|  |.:.
  Rat   373 --------KCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQVPQDPEVTP--QEIM 427

  Fly  1130 LPKTPD 1135
            .|.:.|
  Rat   428 NPTSSD 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594 36/98 (37%)
PH_CNK_insect-like 720..810 CDD:270135 34/94 (36%)
Ipcef1XP_017444823.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61858472
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T618174
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12844
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.