DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Ipcef1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_011241382.1 Gene:Ipcef1 MGIID:2444159 Length:433 Species:Mus musculus

Alignment Length:461 Identity:107/462 (23%)
Similarity:174/462 (38%) Gaps:91/462 (20%)


  Fly   707 RRNTNLKLLGTGDIQGHLYRRKKNHRGV---TYWARIYFVMLDTILYGFRSKQSTSASLVIFLPG 768
            ||..:.|.||..|.||.||  ||..:|.   ..|.:.:.|:..:.||.:.::.:..|...:.|..
Mouse    26 RRRISCKDLGHADCQGWLY--KKKEKGTFLSNKWKKFWVVLKGSSLYWYSNQMAEKADGFVNLSD 88

  Fly   769 FTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDL 832
            |||..|.|. .|.:|||:.| ..|:||||||:|..:|.|::.|..|      .|..:.....::.
Mouse    89 FTVERASEC-KKKNAFKINHPQIKAFYFAAENLQEMNVWLNKLGFA------VTHQESITKDEEC 146

  Fly   833 YSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTF 897
            |||::....|   :.::  :.|.|..:..|..:....:.....||:|.:.|...  ||....||.
Mouse   147 YSESEQEDPE---VAVE--APPPPYASTTSSPVVRVDAAQWASSSSPKRRETSC--SFSSLENTV 204

  Fly   898 KSSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHDPAMPPT---QIPPLVGPKLSRSS 959
            |:.:...||.    :::.:|:..:...|         |...|..:|.|   |:..|...:.|...
Mouse   205 KAPSQFSSSG----SKERQSWHNIVNSS---------PATEDAGLPLTFAEQVHTLAFSEASNCQ 256

  Fly   960 SRSSVVSGTESAV-----SLSASILGPPASPAPTPTPTATPTSLQHQ---SSEESPSQSQSQS-- 1014
            :..:....:|..:     |...|.|.........|...|.......:   |||:...:...:|  
Mouse   257 APENNCITSEGGLLNLLSSDDTSSLNNNKDHLTVPDRAAGSRMADREEIKSSEDDEMEKLYKSLE 321

  Fly  1015 -----------PSSKSSLKKAPFNFL-HASNPNLVEFDFHTSKTLLPKMSVGNTLDHGHNIQGFV 1067
                       ||:|..|:|   :|: ...||::.| ..|..:||      .:||          
Mouse   322 QASLSPLGDRRPSTKKELRK---SFVKRCKNPSINE-KLHKIRTL------NSTL---------- 366

  Fly  1068 TLKDLMLRKQEEEAQEMYNNRV---HLGVEKHKHARTESTASQQSAMSSSVTKPLEKLPKIQSVS 1129
                    |.:|....|.|..:   .|...|::..:..:|...|........:..|..|  |.|.
Mouse   367 --------KCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQAPQDPEVTP--QEVM 421

  Fly  1130 LPKTPD 1135
            .|.:.|
Mouse   422 NPTSSD 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910
SAM 7..74 CDD:197735
CRIC_ras_sig 82..165 CDD:287501
PDZ_signaling 206..283 CDD:238492
PH 720..814 CDD:278594 35/98 (36%)
PH_CNK_insect-like 720..810 CDD:270135 33/94 (35%)
Ipcef1XP_011241382.1 PH_CNK_mammalian-like 25..138 CDD:269962 42/121 (35%)
PH 39..130 CDD:278594 33/94 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61856840
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12844
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.