DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Cnksr3

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001012061.1 Gene:Cnksr3 RGDID:1307544 Length:555 Species:Rattus norvegicus

Alignment Length:585 Identity:162/586 (28%)
Similarity:250/586 (43%) Gaps:110/586 (19%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :.:|:|.||.||.:|||:.::.|:::|.:::|.|..||.|...:||.||:.||||||:|||||:.
  Rat     4 VTKWSPKQVVDWTRGLDDCLQPYVHKFEREKIDGEQLLKISHQDLEELGVTRIGHQELVLEAVDL 68

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAE-------STKIDTRILHDITRTIATLKP 128
            |...:|.|:.||::.:.|.:..::.||...::.....       |.|.....|..:...|...|.
  Rat    69 LCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKPPNEFLTSVVELIGAAKA 133

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDI 193
            |:..|:|.||............:::..|:|.|...:|....:....:....:.|..:.:.::...
  Rat   134 LLAWLDRAPFTGITDLSVTKNKIIQLCLDLTTAVQKDCLVAEMEDKVLNVVKVLNGICDKMMHST 198

  Fly   194 SDPMVLQPASLNLVTLKK-RESE-LGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINY 256
            :||::.|.|.|..|.|.. |..| ||..|:|:|:|:|.:|....||||..|.||..|||::|:|.
  Rat   199 TDPVMSQCACLEEVHLPNVRPGEGLGMYIKSTYDGLHVITGTTENSPADRSQKIHAGDEVIQVNR 263

  Fly   257 QTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQM---- 317
            |||||||.:.:::.|||....|||.:||||..:..|         .|:..:|:  ||...:    
  Rat   264 QTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFSF---------TPAPLKNL--RWKPPLVQTS 317

  Fly   318 PSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVL------TKANPVSSASDSDSSCSDIP 376
            |.|..              |.|.......||..||..:|      ..|.|.|...::.|......
  Rat   318 PPPTT--------------TQSPESTMDASLKKEKPAILDLYIPPPPAVPYSPRDENVSFSYRGH 368

  Fly   377 TPTDPKLAAREIRLYYPKPRALL-----QRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNC 436
            |.:...|..|:   ....|.:.|     :||.||...:.|                ||....||.
  Rat   369 TKSKQPLPGRK---GSESPNSFLDQESQRRRFTITDSDQL----------------PGYSVGTNI 414

  Fly   437 DPGSPSIRDKSISFGYGLEMAARPTTC------IGIA---------GDTSTDKARRMFHEARKLK 486
            .|  ..:|.|:.|:|     ..||.:.      :||.         |....|...|.|...| :.
  Rat   415 LP--IKMRGKTPSYG-----KPRPLSMPADGNWMGIVDPFAKPRGHGRKGEDALCRYFSNER-IT 471

  Fly   487 QLTEDSQREFLVDRYKPGVSKVVRFD--AKEDYVMKNEKFI----CNVENTILETFEPIPFADEG 545
            .:.|:|            .|.|.||.  ..|.::::...:|    |.: |:.|.:...|||.:||
  Rat   472 PIIEES------------ASPVYRFSRPLTERHLVRGADYIRGSRCYI-NSDLHSSATIPFQEEG 523

  Fly   546  545
              Rat   524  523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 32/68 (47%)
SAM 7..74 CDD:197735 32/67 (48%)
CRIC_ras_sig 82..165 CDD:287501 17/90 (19%)
PDZ_signaling 206..283 CDD:238492 37/79 (47%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
Cnksr3NP_001012061.1 SAM_CNK1,2,3-suppressor 4..72 CDD:188910 32/68 (47%)
SAM 4..69 CDD:197735 31/65 (48%)
CRIC_ras_sig 80..171 CDD:287501 18/91 (20%)
PDZ 221..305 CDD:294084 40/93 (43%)
DUF1170 334..545 CDD:284152 52/231 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61858407
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 LDO PTHR12844
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
87.710

Return to query results.
Submit another query.