DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Cnksr1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001034100.1 Gene:Cnksr1 RGDID:1311879 Length:704 Species:Rattus norvegicus

Alignment Length:1161 Identity:223/1162 (19%)
Similarity:344/1162 (30%) Gaps:483/1162 (42%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :..|||.:|..|::|||:.::.  |.|...|:.|:.||.:.|..||.|.:..:||||::|..||.
  Rat     4 VETWTPGKVAAWLRGLDDVLQD--YPFEDWELPGKYLLQLCPQNLEALTVWPLGHQELILHGVEQ 66

  Fly    71 LRNFHYHLKNDNLQFMA---LHVATAAKNLHRELARNHAESTKIDTRILHDITRTIATLKPLVGS 132
            ||.....|:.:||:.:|   |....|.::|.:...|:.|| |..|  :|:.....:.....|:..
  Rat    67 LRALGSKLQTENLKSLAQGLLDRTQAFQSLVQGRLRDCAE-TPAD--VLNAAVELVREAHALLSW 128

  Fly   133 LERTPFRKQEMYREYCGNV-LKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDISDP 196
            |.|..|.....: ..|..: :.|| ||..:...|....:......:...|:..:.:.::....:.
  Rat   129 LNRYLFTHLNDF-SACQEIGVLCG-ELGQVLQEDCLEAEKESNTLRICGRVAGICHNILGCSPEE 191

  Fly   197 MVLQPASLNLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINYQTVVG 261
            ::.|.|.|.||.|   :...|..|.::.|.:|.|:  :....|....:|..||||:|||.|.|||
  Rat   192 LLEQRAVLELVQL---DDPSGLEIHTTSNCLHFVS--RVGVQAATGSQILPGDEIIQINEQVVVG 251

  Fly   262 WQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMPSPRAAFLT 326
            |.|:.:|..|......|.|.:||.|                                        
  Rat   252 WPHKNMLRELLREPARVSLVLKKIP---------------------------------------- 276

  Fly   327 LDTEQLATGGTGSAVPD-PSKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPTD-PKLAAREIR 389
                          ||: |||                              ||.| |:..::.:.
  Rat   277 --------------VPETPSK------------------------------TPPDSPQRLSQSLP 297

  Fly   390 LYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPSIRDKSISFGYGL 454
            |..|.||                       ||                                 
  Rat   298 LNPPSPR-----------------------VP--------------------------------- 306

  Fly   455 EMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKEDYVM 519
                                                   ||.|             ||.|     
  Rat   307 ---------------------------------------REGL-------------FDFK----- 314

  Fly   520 KNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTENAEELLEAINLATKGQDLPLAEAIN 584
                                                              |.|.|...|      
  Rat   315 --------------------------------------------------LFTDGNPSP------ 323

  Fly   585 MPLLQQGRRGRLDKSHSTPAY-DNSGEESDTPPAIEPRKEFLLVTPPAPP-PRPRKQREMTPPAV 647
                             :||: |::..::...|           |||.|| ..|.:..|      
  Rat   324 -----------------SPAWTDSTSLDAQPTP-----------TPPGPPGTLPEETAE------ 354

  Fly   648 PPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHTPSKSRTLTLKKKHSLMAK--RRNT 710
                                   |:.....:|           ||.|:..|....:..:  ||..
  Rat   355 -----------------------PLEASGHLD-----------KSPTVGRKNSKGIATRLSRRRV 385

  Fly   711 NLKLLGTGDIQGHLYRRK--KNHRGVTYWARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSL 773
            :.:.||..|..|.|..||  ....|.. |.|.:||:....||.:|..|...|..:|.:..:::..
  Rat   386 SCRELGLPDCDGWLLLRKVPGGFMGAR-WRRCWFVLKGHTLYWYRQPQDEKAEGLINISNYSLEC 449

  Fly   774 AKEVHSKPHAFKVYHTA-KSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSEND 837
            ..: ..|.:.|::.|.. |.|.||:|:|..|:.||..|.....|. .:.|.......:|.|||.:
  Rat   450 GHD-QKKKYVFQLTHDVYKPFIFASETLSDLSMWVRHLVTCISKY-QTLGRAPSAREEDCYSETE 512

  Fly   838 SSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSSAA 902
            :  |:.|.......::|.|          ......|.||::|::..|          .:|.||. 
  Rat   513 A--EDPDEEAGSRSASPGP----------AQAWNDTSPSASPLQSPR----------TSFGSSL- 554

  Fly   903 KPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHDPAMPPTQIPPLVGPKLSRSSSRSSVVSG 967
             .|||           |.:.|...|::.|                                    
  Rat   555 -DSSD-----------RALEGMVQGLRQG------------------------------------ 571

  Fly   968 TESAVSLSASILGPPASPAPTPTPTATPTSLQHQSSEESPSQSQSQSPSSKSSLKKAPFNFLHAS 1032
                   ..|:||             .|..|.|:....|                     |:..:
  Rat   572 -------GVSLLG-------------QPQPLTHEQWRSS---------------------FMRRN 595

  Fly  1033 -NPNLVEFDFHTSK------TLLPKMSVGNTLDHGHNIQGFVTLKDLMLRKQEEEAQEMYNN--R 1088
             :|:|.|   |..:      ||..|:.....|:   .:.|...|.....|:.:|:..|:|:.  |
  Rat   596 RDPHLNE---HVHRVRALQSTLKAKLQELQVLE---EVLGDPELTGAKFRQWKEQNHELYSEGLR 654

  Fly  1089 VHLGVEKHKHARTESTASQQSAMSSSVTKPLEKLPKIQSVSLPKTPDYEISFKPDD 1144
            ...|:    .|:|.|......:...| .:||...|:..|...|.||  |.|.:|.|
  Rat   655 TWGGM----WAQTSSPDPNTDSRGQS-PQPLPSDPEEPSQLFPSTP--ENSLQPPD 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 27/68 (40%)
SAM 7..74 CDD:197735 27/67 (40%)
CRIC_ras_sig 82..165 CDD:287501 21/87 (24%)
PDZ_signaling 206..283 CDD:238492 27/77 (35%)
PH 720..814 CDD:278594 28/97 (29%)
PH_CNK_insect-like 720..810 CDD:270135 27/93 (29%)
Cnksr1NP_001034100.1 SAM_superfamily 4..70 CDD:301707 27/68 (40%)
SAM 4..69 CDD:197735 27/67 (40%)
CRIC_ras_sig 78..161 CDD:287501 22/88 (25%)
PDZ_signaling 205..273 CDD:238492 24/70 (34%)
PH_CNK_mammalian-like 381..494 CDD:269962 34/116 (29%)
PH 395..491 CDD:278594 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62006391
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12844
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.