Sequence 1: | NP_001286524.1 | Gene: | cnk | FlyBaseID: | FBgn0286070 | Length: | 1557 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006512804.1 | Gene: | Samd3 | MGIID: | 2685469 | Length: | 541 | Species: | Mus musculus |
Alignment Length: | 296 | Identity: | 55/297 (19%) |
---|---|---|---|
Similarity: | 105/297 (35%) | Gaps: | 101/297 (34%) |
Fly 9 WTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRN 73
Fly 74 FHYHLKN---------------------------------------DNLQFMALHVATAAKNLHR 99
Fly 100 ELARNHA---------------------ESTKID----TRILH----DITRTIATLKPLVGSLER 135
Fly 136 TPFRKQEMYREYCGNVLK---------CGLELATIAHRDRFALQPVPAIRQSAERLENLANF--- 188
Fly 189 ---VIQDISDPMVLQPASLNLVTLKKRESELGFNIE 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cnk | NP_001286524.1 | SAM_CNK1,2,3-suppressor | 6..74 | CDD:188910 | 15/65 (23%) |
SAM | 7..74 | CDD:197735 | 15/65 (23%) | ||
CRIC_ras_sig | 82..165 | CDD:287501 | 25/121 (21%) | ||
PDZ_signaling | 206..283 | CDD:238492 | 3/17 (18%) | ||
PH | 720..814 | CDD:278594 | |||
PH_CNK_insect-like | 720..810 | CDD:270135 | |||
Samd3 | XP_006512804.1 | SAM_Samd3 | 28..93 | CDD:188925 | 15/65 (23%) |
SAM | 28..92 | CDD:197735 | 15/64 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | C61982633 | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |