DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnk and Samd3

DIOPT Version :9

Sequence 1:NP_001286524.1 Gene:cnk / 36952 FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_006512805.1 Gene:Samd3 / 268288 MGIID:2685469 Length:527 Species:Mus musculus


Alignment Length:296 Identity:55/296 - (18%)
Similarity:105/296 - (35%) Gaps:101/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRN 73
            |:.|||..|:  :::::...:..|.::|:.|..||.:....::.| :.:||||.::::.::..:.
Mouse    17 WSVDQVCKWL--VEKNLGELVPRFQEEEVSGATLLALNDRMVQQL-VKKIGHQAVLMDFIKKYKQ 78

  Fly    74 FHYHLKN---------------------------------------DNLQFMALHVATAAKNLHR 99
            .:..||.                                       || :.:...|....:|:..
Mouse    79 G
NQELKPTGGPADTSTLTPAQAAPEHEQNPSPTSHGDQTSLYPAVLDN-RLIDQRVLKQRRNVKH 142

  Fly   100 ELARNHA---------------------ESTKID----TRILH----DITRTIATLKPLVGSLER 135
            .|||:.|                     |..:.|    .||:.    |:|      |.|.|||..
Mouse   143 VLARHKALQWTKSYILPEFPYDVKCMLVEQKRPDHSMRIRIIEFLQADMT------KYLEGSLYP 201

  Fly   136 TPFRKQEMYREYCGNVLK---------CGLELATIAHRDRFALQPVPAIRQSAERLENLANF--- 188
            |    .:.|.:....:|:         ||..|...|.:|||.....| |....:.:.|...|   
Mouse   202 T----TQQYNDVVNALLQAHPFLDEDGCGFFLWKRALKDRFKYIRRP-IEDDEQVMRNKCKFGHR 261

  Fly   189 ---VIQDISDPMVLQPASLNLVTLKKRESELGFNIE 221
               ..:.::|   :|...:.:|.:|:..:.|...::
Mouse   262 RGQTRKSLAD---IQSNEIKIVQIKEESAHLDSEVD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 15/64 (23%)
SAM 7..74 CDD:197735 15/64 (23%)
CRIC_ras_sig 82..165 CDD:287501 25/120 (21%)
PDZ_signaling 206..283 CDD:238492 3/16 (19%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
Samd3XP_006512805.1 SAM_Samd3 14..79 CDD:188925 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.