DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and CNKSR2

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_055742.2 Gene:CNKSR2 HGNCID:19701 Length:1034 Species:Homo sapiens

Alignment Length:1099 Identity:266/1100 (24%)
Similarity:425/1100 (39%) Gaps:285/1100 (26%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :::|:|.||.||:||||:.::.|:..|.:::|.|..||.|...|||:||:.||||||::||||:.
Human     8 VSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAVDL 72

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA----RNHAE---STKIDTRILHDITRTIATLKP 128
            |...:|.|:.:||:.::..:..:||||...:.    ..|.:   |.|:....|..:...|...|.
Human    73 LCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKS 137

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDI 193
            |:..|:|:||.....|.....||::..|||.||..:|....:....|....:.|..:.:.:|...
Human   138 LLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISLS 202

  Fly   194 SDPMVLQPASLNLVTLK--KRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINY 256
            |||:|.|.|.|.::.|.  |....||..|:|:|:|:|.:|....||||....||..|||::|:|:
Human   203 SDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDEVIQVNH 267

  Fly   257 QTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARW---AAQMP 318
            |||||||.:.::..|||....|:||:||||:....         ..|:..:||  ||   |.|..
Human   268 QTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLT---------SAPALLKNM--RWKPLALQPL 321

  Fly   319 SPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSC-SDI---PTPT 379
            .||:                     |:.|       |.|.::.:|:.:..|||. .|:   |.|.
Human   322 IPRS---------------------PTSS-------VATPSSTISTPTKRDSSALQDLYIPPPPA 358

  Fly   380 DPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPS-- 442
            :|         |.|:.    ::.|..|         .||       |...:|.|.:....||:  
Human   359 EP---------YIPRD----EKGNLPC---------EDL-------RGHMVGKPVHKGSESPNSF 394

  Fly   443 -----------IRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREF 496
                       :.:.::.:.|..|           .|.:|:...|.......||:.::...:..:
Human   395 LDQEYRKRFNIVEEDTVLYCYEYE-----------KGRSSSQGRRESTPTYGKLRPISMPVEYNW 448

  Fly   497 LVDRYKPGVSKVVRFDAKEDYV---MKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKT 558
            :.|...|  :|:.|...:|:.:   |.|||..                     ::.....||.|.
Human   449 VGDYEDP--NKMKRDSRRENSLLRYMSNEKIA---------------------QEEYMFQRNSKK 490

  Fly   559 ENAEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSHSTPAYDNSGEESDTPPAIEPRKE 623
            :..:                          :..::|  |||:|...|                  
Human   491 DTGK--------------------------KSKKKG--DKSNSPTHY------------------ 509

  Fly   624 FLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSIS---IPVPVPVPAAVDPSEISE 685
                                            |:.|:..:.::.   :..|||........:.|.
Human   510 --------------------------------SLLPSLQMDALRQDIMGTPVPETTLYHTFQQSS 542

  Fly   686 LHTPSKSRTLTLKKKHSLMAK-RRNTNLKLLGTGDIQGHLYRRKKNHRGVTY----WARIYFVML 745
            |...||.     |.|..:..| :|..:.|.||.||.:|.|:::|.   ..:|    |.:.:||:.
Human   543 LQHKSKK-----KNKGPIAGKSKRRISCKDLGRGDCEGWLWKKKD---AKSYFSQKWKKYWFVLK 599

  Fly   746 DTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDF 809
            |..||.:.:::...|...|.||.|.:..|.|...| :|||..| ..||||||||.||.:|:|::.
Human   600 DASLYWYINEEDEKAEGFISLPEFKIDRASECRKK-YAFKACHPKIKSFYFAAEHLDDMNRWLNR 663

  Fly   810 LRQASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLS---- 870
            :...:.........|   ..:|.:||:|.  ||.|........:|.|..:......||:.:    
Human   664 INMLTAGYAERERIK---QEQDYWSESDK--EEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYV 723

  Fly   871 -------GGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYR---KVPGGS 925
                   ..|..|.:...||     .||:  ....|||..|   |.....|.||::   :.|..|
Human   724 EAKHSRLSSTETSQSQSSHE-----EFRQ--EVTGSSAVSP---IRKTASQRRSWQDLIETPLTS 778

  Fly   926 FGIQI--------------GANTPGYHDPAMPPTQ---IPPLVGPKLSRSSSRSSVVSGTESA-- 971
            .|:..              .|.:|.:...:..|||   :....||.....|.|..|::|....  
Human   779 SGLHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGGKPR 843

  Fly   972 -------VSLSASILGPPASPAPTPTPTATPTSLQHQSSEESPSQSQSQSPSSKSSLKK 1023
                   ...:...|..|.|..........|...:.:..||...::..::...||..::
Human   844 SFTLPRDSGFNHCCLNAPVSACDPQDDVQPPEVEEEEEEEEEEGEAAGENIGEKSESRE 902

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 33/68 (49%)
SAM 7..74 CDD:197735 33/67 (49%)
CRIC_ras_sig 82..165 CDD:287501 25/90 (28%)
PDZ_signaling 206..283 CDD:238492 34/79 (43%)
PH 720..814 CDD:278594 34/99 (34%)
PH_CNK_insect-like 720..810 CDD:270135 34/95 (36%)
CNKSR2NP_055742.2 SAM_CNK1,2,3-suppressor 8..76 CDD:188910 33/68 (49%)
SAM 8..73 CDD:197735 32/65 (49%)
CRIC_ras_sig 84..176 CDD:287501 26/92 (28%)
Peptidase_C98 139..>218 CDD:292138 23/79 (29%)
PDZ_signaling 222..294 CDD:238492 33/72 (46%)
DUF1170 341..561 CDD:284152 55/366 (15%)
PH_CNK_mammalian-like 559..672 CDD:269962 40/117 (34%)
PH 573..669 CDD:278594 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61946908
eggNOG 1 0.900 E1_KOG1738
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I3003
Isobase 1 0.950 0 Normalized mean entropy S6579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T609237
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3250
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.