DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Cnksr3

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_011241381.1 Gene:Cnksr3 MGIID:2674130 Length:578 Species:Mus musculus

Alignment Length:590 Identity:161/591 (27%)
Similarity:245/591 (41%) Gaps:123/591 (21%)


  Fly     9 WTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRN 73
            |.|.| ..|..|||:.::.|:::|.:::|.|..||.|...:||.||:.||||||:|||||:.|..
Mouse    31 WGPKQ-DPWKSGLDDCLQPYVHKFEREKIDGEQLLKISHQDLEELGVTRIGHQELVLEAVDLLCA 94

  Fly    74 FHYHLKNDNLQFMALHVATAAKNLHRELARNHAE-------STKIDTRILHDITRTIATLKPLVG 131
            .:|.|:.|.::.:.|.:..::.||...::.....       |.|.....|..:...|...|.|:.
Mouse    95 LNYGLETDTMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKPPNEFLTSVVELIGAAKALLA 159

  Fly   132 SLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDISDP 196
            .|:|.||............:::..|:|.|...:|....:....:....:.|..:.:..::..:||
Mouse   160 WLDRAPFTGITDLSVTKNKIIQLCLDLTTAVQKDCLIAEMEDKVLNVVKVLNGICDKTMRSTTDP 224

  Fly   197 MVLQPASLNLVTLKK-RESE-LGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINYQTV 259
            ::.|.|.|..|.|.. |..| ||..|:|:|:|:|.:|....||||..|.||..|||::|:|.|||
Mouse   225 VMSQCACLEEVHLPNVRPGEGLGMYIKSTYDGLHVITGTTENSPADRSQKIHAGDEVIQVNRQTV 289

  Fly   260 VGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQM----PSP 320
            ||||.:.::..|||....|||.:||||..:..|         .|:..:|:  ||...:    |.|
Mouse   290 VGWQLKNLVRKLRENPTGVVLLLKKRPTGSFSF---------TPAPLKNL--RWKPPLVQTSPPP 343

  Fly   321 RAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVL------TKANPVSSASDSDS------SCS 373
            ..              |.|.......||..||..:|      ..|.|.|...::.|      |.|
Mouse   344 TT--------------TQSPESTMDASLKKEKPAILDLYIPPPPAVPYSPRDENVSFGYRGHSKS 394

  Fly   374 DIPTPTDPKLAAREIRLYYPKPRALL-----QRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSP 433
            ..|.|         :|.....|.:.|     :||.||...:.|                ||....
Mouse   395 KQPLP---------VRKGSESPNSFLDQESQRRRFTIADSDQL----------------PGYSVE 434

  Fly   434 TNCDPGSPSIRDKSISFGYGLEMAARPTTC------IGIA---------GDTSTDKARRMFHEAR 483
            ||..|  ..:|.|:.|:|     ..||.:.      :||.         |....|...|.|...|
Mouse   435 TNVLP--TKMRGKTPSYG-----KPRPLSMPADGNWMGIVDPFAKPRGNGRKGEDALCRYFSNER 492

  Fly   484 KLKQLTEDSQREFLVDRYKPGVSKVVRFD--AKEDYVMKNEKFI----CNVENTILETFEPIPFA 542
             :..:||:|            .|.:.||.  ..|.::::...:|    |.: |:.|.:...|||.
Mouse   493 -ITPITEES------------ASPMYRFSRPLTERHLVRGADYIRGSRCYI-NSDLHSSATIPFQ 543

  Fly   543 DEGDE 547
            :||.:
Mouse   544 EEGSK 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 30/65 (46%)
SAM 7..74 CDD:197735 30/65 (46%)
CRIC_ras_sig 82..165 CDD:287501 16/90 (18%)
PDZ_signaling 206..283 CDD:238492 37/79 (47%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
Cnksr3XP_011241381.1 SAM_CNK1,2,3-suppressor 31..95 CDD:188910 30/65 (46%)
SAM <46..92 CDD:197735 22/46 (48%)
CRIC_ras_sig 103..194 CDD:287501 17/91 (19%)
PDZ 244..328 CDD:294084 40/93 (43%)
DUF1170 357..568 CDD:284152 54/239 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61856758
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T616056
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 LDO PTHR12844
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3250
TreeFam 1 0.960
109.740

Return to query results.
Submit another query.