DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and Cnksr1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001074516.1 Gene:Cnksr1 MGIID:2670958 Length:700 Species:Mus musculus

Alignment Length:1196 Identity:224/1197 (19%)
Similarity:344/1197 (29%) Gaps:557/1197 (47%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :..|||.:|..|::|||::::.  |.|...::.|:.||.:.|..||.|.:..:||||::|:.||.
Mouse     4 VEAWTPGKVAAWLRGLDDALQD--YPFEDWQLPGKYLLQLCPQSLEALTVWPLGHQELILDGVEQ 66

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILHDITRTIATLKPLVGSLER 135
            ||....:|:.:|||.:|..:          |.|..|..:.:...:               |:...
Mouse    67 LRALGSNLQTENLQSLAQGL----------LERTQAFQSLVQGSL---------------GNCAE 106

  Fly   136 TPFRKQEMYREYCGNVLKCGLELATIAH--------------RDRFALQPVPAI----------- 175
            ||           .:|||..:||...||              .|..|.|.:..:           
Mouse   107 TP-----------ADVLKAAVELVREAHALLSWLNGYLFSHLNDFSACQEIGVLCGELGQVLQED 160

  Fly   176 RQSAERLENLANF----------VIQDISDPMVLQPASLNLVTLKKRESELGFNIESSYNGIHRV 230
            ...||:..|:...          ::....:.::.|.|.|..|.:   :...|..|.::.|.:|.|
Mouse   161 CPEAEKERNILRICSHVAGICHNILSCSPEELLEQKAVLESVQV---DDPSGLEIHTTSNCLHFV 222

  Fly   231 TDIKYNSPAHNSGKIEDGDEIVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQI 295
            :  :....|..|.:|..||||||:|.|.||||.|:.:|..|......|.|.:||.|         
Mouse   223 S--RVGVQAATSSQILPGDEIVQVNEQVVVGWSHKNMLRELLREPAKVSLVLKKIP--------- 276

  Fly   296 YMQPYRLPSKKRNMAARWAAQMPSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKAN 360
                                                         ||:                .
Mouse   277 ---------------------------------------------VPE----------------T 280

  Fly   361 PVSSASDSDSSCSDIPTPTDPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHE 425
            |..::.||            |.|.::.:.|..|.||                       |||   
Mouse   281 PSQTSLDS------------PHLLSQSLPLNPPSPR-----------------------VPS--- 307

  Fly   426 RKPGIGSPTNCDPGSPSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTE 490
                                                                             
Mouse   308 ----------------------------------------------------------------- 307

  Fly   491 DSQREFLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRN 555
                                                                 ||          
Mouse   308 -----------------------------------------------------EG---------- 309

  Fly   556 CKTENAEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSHSTPAY-DNSGEESDTPPAIE 619
                                           ||..|..|      .:||: |::..::.:||   
Mouse   310 -------------------------------LLADGTPG------PSPAWTDSTSFDAQSPP--- 334

  Fly   620 PRKEFLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEIS 684
                    |||.||                                           .|.|.|.:
Mouse   335 --------TPPGPP-------------------------------------------GVLPEETA 348

  Fly   685 E-LHT---PSKSRTLTLKKKHSLMAK--RRNTNLKLLGTGDIQGHLYRRK--KNHRGVTYWARIY 741
            | |.:   |.||..|..||...:..:  ||..:.:.||..|..|.|..||  ....| ..|.|.:
Mouse   349 EPLESSGHPDKSPILGRKKSKGIATRLSRRRVSCRELGLPDCDGWLLLRKVPGGFMG-PRWRRCW 412

  Fly   742 FVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYHTA-KSFYFAAESLDALNQ 805
            ||:....||.:|..|...|..:|.|..:::....: ..|.:.|::.|.. |.|.||||:|..|::
Mouse   413 FVLKGHTLYWYRQPQDEKAEGLINLSNYSLESGHD-QKKKYVFQLTHDVYKPFIFAAETLSDLSK 476

  Fly   806 WVDFL------RQASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQNLSTPSPQGNKESMS 864
            ||..|      .||..:.|.|...      :|.|||.::  |:.|.......::|.|     :.:
Mouse   477 WVRHLITCISKYQAQGRAPSSARE------EDCYSETEA--EDPDEEAGSRSASPGP-----AQA 528

  Fly   865 MSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQ 929
            .|     .|.|.::|::..|          .:|.||   |.|          |.|.:.|...|::
Mouse   529 WS-----DTSPVASPLQSPR----------TSFNSS---PDS----------SDRALEGMVQGLR 565

  Fly   930 IGANTPGYHDPAMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSLSASILGPPASPAPTPTPTAT 994
            .|                                           ..|:||             .
Mouse   566 QG-------------------------------------------GVSLLG-------------Q 574

  Fly   995 PTSLQHQSSEESPSQSQSQSPSSKSSLKKAPFNFLHAS-NPNLVEFDFH---TSKTLLPKMSVGN 1055
            |..|.|:....|                     |:..: :|:|.|....   ...||..|:....
Mouse   575 PQPLTHEQWRSS---------------------FMRRNRDPHLNERAHRIRALQSTLKAKLQELQ 618

  Fly  1056 TLDHGHNIQGFVTLKDLMLRKQEEEAQEMYNN--RVHLGVEKHKHARTESTASQQSAMSSSVTKP 1118
            .|:   .:.|...|.....|:.:|:.||:|:.  |...|.    .|:|.|:.....:.:.| .:|
Mouse   619 ALE---EVLGDPELTSAKFRQWKEQNQELYSEGLRTWGGT----WAQTSSSDPNSDSRAHS-PQP 675

  Fly  1119 LEKLPKIQSVSLPKTPDYEISFKPDD 1144
            |...|:..|...|.||  |.|.:|.|
Mouse   676 LPFDPEEPSQLFPLTP--ENSRQPPD 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 26/68 (38%)
SAM 7..74 CDD:197735 26/67 (39%)
CRIC_ras_sig 82..165 CDD:287501 17/97 (18%)
PDZ_signaling 206..283 CDD:238492 26/77 (34%)
PH 720..814 CDD:278594 32/103 (31%)
PH_CNK_insect-like 720..810 CDD:270135 29/93 (31%)
Cnksr1NP_001074516.1 SAM_superfamily 4..70 CDD:301707 26/68 (38%)
SAM 4..69 CDD:197735 26/67 (39%)
CRIC_ras_sig 78..162 CDD:287501 20/120 (17%)
PDZ_signaling 205..273 CDD:238492 25/70 (36%)
PH_CNK_mammalian-like 376..489 CDD:269962 35/115 (30%)
PH 390..486 CDD:278594 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62005851
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3002
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12844
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.850

Return to query results.
Submit another query.