DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and CNKSR3

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001355045.1 Gene:CNKSR3 HGNCID:23034 Length:561 Species:Homo sapiens

Alignment Length:600 Identity:162/600 (27%)
Similarity:251/600 (42%) Gaps:136/600 (23%)


  Fly     7 AEWTPDQVTDWI------KGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVL 65
            |||.......::      :|||:.::.|:::|.:::|.|..||.|...:||.||:.||||||:||
Human     5 AEWPVRSYLSYLLRALPFQGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQELVL 69

  Fly    66 EAVENLRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAE-------STKIDTRILHDITRTI 123
            |||:.|...:|.|:.||::.:.|.:..::.||...::.....       |.|.....|..:...|
Human    70 EAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEFLTSVVELI 134

  Fly   124 ATLKPLVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANF 188
            ...|.|:..|:|.||.....:......:::..|:|.|...:|.|..:....:....:.|..:.:.
Human   135 GAAKALLAWLDRAPFTGITDFSVTKNKIIQLCLDLTTTVQKDCFVAEMEDKVLTVVKVLNGICDK 199

  Fly   189 VIQDISDPMVLQPASL---NLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDE 250
            .|:..:||::.|.|.|   :|..:|..|. ||..|:|:|:|:|.:|....||||..|.||..|||
Human   200 TIRSTTDPVMSQCACLEEVHLPNIKPGEG-LGMYIKSTYDGLHVITGTTENSPADRSQKIHAGDE 263

  Fly   251 IVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARW-- 313
            ::|:|.|||||||.:.:::.|||....|||.:||||..:..|         .|:..:|:  ||  
Human   264 VIQVNQQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFNF---------TPAPLKNL--RWKP 317

  Fly   314 --------AAQMPSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVL------TKANPVSS 364
                    .|...||.:   |:||                 ||..||..:|      ..|.|.|.
Human   318 PLVQTSPPPATTQSPES---TMDT-----------------SLKKEKSAILDLYIPPPPAVPYSP 362

  Fly   365 ASDS-------DSSCSD-IPTPTDPKLAAREIRLYYPKPRALL-----QRRNTICGCEYLSLKNS 416
            ..::       .|.|.. :|.|...:           .|.:.|     :||.||...:.|     
Human   363 RDENGSFVYGGSSKCKQPLPGPKGSE-----------SPNSFLDQESRRRRFTIADSDQL----- 411

  Fly   417 DLVVPSWHERKPGIGSPTNCDPGSPSIRDKSISFGYGLEMAARPTTC------IGIA-------- 467
                       ||....||..|  ..:|:|:.|:|     ..||.:.      :||.        
Human   412 -----------PGYSVETNILP--TKMREKTPSYG-----KPRPLSMPADGNWMGIVDPFARPRG 458

  Fly   468 -GDTSTDKARRMFHEARKLKQLTEDSQREFLVDRYKPGVSK-VVRFDAKEDYVMKNEKFICNVEN 530
             |....|...|.|...|....:.|.|...:...|  |...: :||   ..||:..:..:|    |
Human   459 HGRKGEDALCRYFSNERIPPIIEESSSPPYRFSR--PTTERHLVR---GADYIRGSRCYI----N 514

  Fly   531 TILETFEPIPFADEG 545
            :.|.:...|||.:||
Human   515 SDLHSSATIPFQEEG 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 29/73 (40%)
SAM 7..74 CDD:197735 29/73 (40%)
CRIC_ras_sig 82..165 CDD:287501 17/90 (19%)
PDZ_signaling 206..283 CDD:238492 36/77 (47%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
CNKSR3NP_001355045.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61858131
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T609237
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3250
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.