DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and CNKSR1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001284576.1 Gene:CNKSR1 HGNCID:19700 Length:720 Species:Homo sapiens

Alignment Length:1079 Identity:194/1080 (18%)
Similarity:311/1080 (29%) Gaps:428/1080 (40%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :..|||.:|..|::|||:|::.  |.|...::.|:.||.:.|..||.|.:..:||||::|..||.
Human     4 VETWTPGKVATWLRGLDDSLQD--YPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQ 66

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILHDITRTIATLKPLVGSLER 135
            |:.....|:.:|||.:...:..|..:....:.....:..|....:|......:.....|:..|.|
Human    67 LQALSSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSR 131

  Fly   136 TPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDISDPMVLQ 200
            ..|.....: ..|..:.....||:.:.|.|..|.:....:.:....:..:.:.::......::.|
Human   132 YLFSHLNDF-SACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQ 195

  Fly   201 PASLNLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINYQTV------ 259
            .|.|..|.|   :|.||..|.::.|..|.|:.:....|..:..:|:.|||:||||.|.|      
Human   196 KAVLEQVQL---DSPLGLEIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREERD 257

  Fly   260 -VGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMPSPRAA 323
             |||..:.::..|......:.|.:||                                       
Human   258 MVGWPRKNMVRELLREPAGLSLVLKK--------------------------------------- 283

  Fly   324 FLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPTDPKLAAREI 388
                             :|.|                             :.|..|.|:      
Human   284 -----------------IPIP-----------------------------ETPPQTPPQ------ 296

  Fly   389 RLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPSIRDKSISFGYG 453
                                          |:.|.|:|.|.: |.....|.:||           
Human   297 ------------------------------VLDSPHQRSPSL-SLAPLSPRAPS----------- 319

  Fly   454 LEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKEDYV 518
                                                                             
Human   320 ----------------------------------------------------------------- 319

  Fly   519 MKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTENAEELLEAINLATKGQDLPLAEAI 583
                                        ||..                                 
Human   320 ----------------------------EDVF--------------------------------- 323

  Fly   584 NMPLLQQGRRGRLDKSHSTPAYDNSGEESDTPPAIEPRKEFLLVTPPAPPPRPRKQREMTPPAVP 648
                                |:|.|...|                 |.|.|.......:.|..:|
Human   324 --------------------AFDLSSNPS-----------------PGPSPAWTDSASLGPEPLP 351

  Fly   649 PPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHTPSKSRTLTLKKKHSLMAK--RRNTN 711
            .||..||.: ||....:..:|                 .:|.|| .:..||...|..:  ||..:
Human   352 IPPEPPAIL-PAGVAGTPGLP-----------------ESPDKS-PVGRKKSKGLATRLSRRRVS 397

  Fly   712 LKLLGTGDIQGHLYRRKK--NHRGVTYWARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLA 774
            .:.||..|..|.|..||.  ...| ..|.|.:||:....||.:|..|...|..:|.:..:::...
Human   398 CRELGRPDCDGWLLLRKAPGGFMG-PRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESG 461

  Fly   775 KEVHSKPHAFKVYHTA-KSFYFAAESLDALNQWVDFL------RQASLKVPPSTGSKGGGDAKDL 832
            .: ..|.:.|::.|.. |.|.|||::|..|:.||..|      .|:..:.||..       .:|.
Human   462 HD-QKKKYVFQLTHDVYKPFIFAADTLTDLSMWVRHLITCISKYQSPGRAPPPR-------EEDC 518

  Fly   833 YSENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTF 897
            |||.::  |:.|.....:.::|||      ......|.|.|.|::.|.  :|....||...|::.
Human   519 YSETEA--EDPDDEAGSHSASPSP------AQAGSPLHGDTSPAATPT--QRSPRTSFGSLTDSS 573

  Fly   898 K---------------SSAAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHDPAMPPTQI 947
            :               |...:|.   |:..||:||       ||               |...:.
Human   574 EEALEGMVRGLRQGGVSLLGQPQ---PLTQEQWRS-------SF---------------MRRNRD 613

  Fly   948 PPLVGPKLSRSSSRSSVVSGTESAVSLSASILGPPA-----------------SPAPTPTPTATP 995
            |.| ..::.|..:..|.:......:.:...:||.|.                 |........|..
Human   614 PQL-NERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSEGLGAWGVAQA 677

  Fly   996 TSLQHQSSEESPSQSQSQSPS------------SKSSLK 1022
            ....|..:.:|..||....||            |:|||:
Human   678 EGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSESSLR 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 26/68 (38%)
SAM 7..74 CDD:197735 26/67 (39%)
CRIC_ras_sig 82..165 CDD:287501 14/83 (17%)
PDZ_signaling 206..283 CDD:238492 25/84 (30%)
PH 720..814 CDD:278594 29/103 (28%)
PH_CNK_insect-like 720..810 CDD:270135 27/93 (29%)
CNKSR1NP_001284576.1 SAM_CNK1,2,3-suppressor 4..70 CDD:188910 26/68 (38%)
CRIC_ras_sig 78..162 CDD:313706 15/85 (18%)
PH_CNK_mammalian-like 392..505 CDD:269962 33/115 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62006273
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12844
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.