DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and LOC100488567

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_017951878.1 Gene:LOC100488567 ID: Length:1024 Species:Xenopus tropicalis

Alignment Length:1245 Identity:293/1246 (24%)
Similarity:465/1246 (37%) Gaps:374/1246 (30%)


  Fly    20 GLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRNFHYHLKNDNLQ 84
            |||:.::.|:..|.:::|.|..||:|...|||.||:.||||||::||||:.|...:|.|:.:||:
 Frog    24 GLDDCLQQYIKNFEREKINGEQLLHITHQELEELGVTRIGHQELILEAVDLLCALNYGLETENLR 88

  Fly    85 FMALHVATAAKNLHRELA----RNHAE---STKIDTRILHDITRTIATLKPLVGSLERTPFRKQE 142
            .::..:..:||||...:.    ..|.:   |.::....|..:...|...|.|:..|:|:||....
 Frog    89 TLSHKLNASAKNLQNFITGRRRSGHYDGRASRRLPNDFLTSVVDLIGAAKNLLAWLDRSPFVSVT 153

  Fly   143 MYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDISDPMVLQPASLNLV 207
            .|.....|:::..|||.||..:|....:....|....:.|..:.:.:|...||.:|.|.|.|.:|
 Frog   154 EYSLLKNNIVQLCLELTTIVQQDCTVYETENKILHVCKTLSGICDHIISLSSDSLVSQSAHLEVV 218

  Fly   208 TLKK-RESE-LGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINYQTVVGWQHRTVLEH 270
            .|.. ..|| ||..|:|:|:|:|.:|....||||....||..|||::|:|:|||||||.:.::..
 Frog   219 HLTNIMPSEGLGMYIKSTYDGLHVITGTTENSPADQCKKIHAGDEVIQVNHQTVVGWQLKNLVNA 283

  Fly   271 LREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARW--AAQMP----SPRAAFLTLDT 329
            |||....|:||:||||::|..         ..|:..:|:  ||  .|..|    ||.:...|   
 Frog   284 LREDPNGVILTLKKRPQNTLA---------SAPALLKNV--RWKPLALQPLIPTSPTSGNTT--- 334

  Fly   330 EQLATGGTGSAVPDPSKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPTDPKLAAREIRLYYPK 394
               .||..|.:    ||..||...:|.. .:|||.                         ||.|:
 Frog   335 ---PTGTIGMS----SKVDSSNLHDVFI-LSPVSG-------------------------LYGPR 366

  Fly   395 PRALLQRRNTICGCEYLSLKNSDLVVPSWHERKPGIGSPTNCDPGSPSIRDKSISFGYGLEMAAR 459
            ...      .|..|:.::              |.|:|........|||         |.||    
 Frog   367 DEI------GIVSCDDIN--------------KYGVGKSGMKGSESPS---------YYLE---- 398

  Fly   460 PTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKEDYVMKNEKF 524
                                ||:.|...|.|....: :...|:.|.|..||         :.||.
 Frog   399 --------------------HESGKYYTLIEGEGHQ-VGSEYERGRSTGVR---------RREKT 433

  Fly   525 ICNVE----------NTILETFEPIPFADEGDEDALETLRNCKTENAEELLEAINLATKGQDLPL 579
            ..:.:          :.:.|:.||..:..:.:...|..|       :::.:..|      |:.|:
 Frog   434 PTHGDLRPVSMPTEYSWLGESKEPNMYKRDSENSLLRYL-------SDDKILVI------QEEPV 485

  Fly   580 AEAINMPLLQQGRRGR-LDKSHSTPAYDNSGEESDTPPAIEPRKEFLLVTPPAPPPRPRKQREMT 643
            .:..|.  ...|||.| ..|:..:|:|..|.....:...::|.::.:|.                
 Frog   486 TQKDNK--RDTGRRSRKKGKNTGSPSYPISPSMLTSTGRLDPAQQDVLT---------------- 532

  Fly   644 PPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHTPS-KSRTLTLKKKHSLM-AK 706
                            .|...|.::|:            ....|:.| :.||....|..||. ..
 Frog   533 ----------------FSLAESNTVPL------------YHSFHSASLRVRTKKRSKGSSLTGGS 569

  Fly   707 RRNTNLKLLGTGDIQGHLYRRKKNHRG--VTYWARIYFVMLDTILYGFRSKQSTSASLVIFLPGF 769
            ||..:.|.||.||.:|.|: :||:.:|  ...|.:.:|::.|:.||.:.::....|...|.||.|
 Frog   570 RRRISCKDLGHGDCEGWLW-KKKDAKGYFTQKWKKYWFILKDSSLYWYTNQNDEKAEGFISLPEF 633

  Fly   770 TVSLAKEVHSKPHAFKVYH-TAKSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLY 833
            .:..|.|...| ||||..| ..|||:||.:.|:.:|:|::.|..|::...|........:| |.:
 Frog   634 RIDRAIECRRK-HAFKACHPKIKSFFFATDCLEEMNRWMNRLGLAAIGYTPDEKDTRPNEA-DYW 696

  Fly   834 SENDSSGEECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPP---SSAPI---KHERGYL----- 887
            ||:|                      ::.:..||||....|.   ||:|.   ||.|.:.     
 Frog   697 SESD----------------------QDDIDGSMTLRQEAPSTVNSSSPFPEPKHGRHFSSESTY 739

  Fly   888 ------DSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYR------KVPGGSFGIQIGANTPGYHDP 940
                  ||.:..|.:..||..:||         ||..|      :.|..|.|:......|     
 Frog   740 SHSSAEDSRQDATGSTHSSGCRPS---------YRERRSWQDLIETPLTSSGLHFLQTVP----- 790

  Fly   941 AMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSLSASILGPPASPAPTPTPTAT-PTSLQHQSSE 1004
                              |....||..|               ..:|.....|| |...:|.:..
 Frog   791 ------------------SDGEYVVGHT---------------GMSPEQRRQATLPVQRRHNNER 822

  Fly  1005 ESP-----------SQSQSQSPSSKSSLKKAPFNFLHASNPNLVEFDFHTSKTLLPKMSVGNTLD 1058
            :.|           |.:::|...|:|                            ||:........
 Frog   823 DGPFPLTECPRGHTSHARTQKQRSQS----------------------------LPRNRDVRVKS 859

  Fly  1059 HGHNIQGFVTLKDLMLRKQEEEAQEMYNNRVHLGVEKHKHARTESTASQQSAMSSSVTKPLEKLP 1123
            .|.|.:           |.||::::..:.|.|...:|.     ||...::|:     |..|::|.
 Frog   860 RGKNTE-----------KLEEKSEDELSKRTHSNSDKE-----ESKKEKRSS-----TDGLQELY 903

  Fly  1124 K-IQSVSLPKTPDYEISFKPD--------------DESIKRTRT-KEGQKLRDFGYELICG--DE 1170
            | ::..||....:..:|.|.:              :|.:.|.|. |...|.::....:|..  ::
 Frog   904 KTLEQASLSAFGEQRLSTKQEFRRSFIKRCNDPIMNEKLHRIRVLKSTVKAKEGDLAIINSLLED 968

  Fly  1171 PSTSSISRQE 1180
            |..||...:|
 Frog   969 PQLSSKKLKE 978

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 26/54 (48%)
SAM 7..74 CDD:197735 26/54 (48%)
CRIC_ras_sig 82..165 CDD:287501 23/90 (26%)
PDZ_signaling 206..283 CDD:238492 36/79 (46%)
PH 720..814 CDD:278594 33/97 (34%)
PH_CNK_insect-like 720..810 CDD:270135 31/93 (33%)
LOC100488567XP_017951878.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.