| Sequence 1: | NP_001286524.1 | Gene: | cnk / 36952 | FlyBaseID: | FBgn0286070 | Length: | 1557 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001135662.1 | Gene: | cnksr3 / 100216222 | XenbaseID: | XB-GENE-5872973 | Length: | 551 | Species: | Xenopus tropicalis |
| Alignment Length: | 599 | Identity: | 155/599 - (25%) |
|---|---|---|---|
| Similarity: | 260/599 - (43%) | Gaps: | 112/599 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
Fly 71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILH--------DITRTIATLK 127
Fly 128 PLVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVP-AIRQSAERLENLANFVIQ 191
Fly 192 DISDPMVLQPASL---NLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQ 253
Fly 254 INYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMP 318
Fly 319 SPRAAFLTLDTEQLATGGTGSAVPDP----SKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPT 379
Fly 380 DPKLAAREI------RLYYP--------KPRALL---QRRNTICGCEYLSLKNSDLVVPSWHERK 427
Fly 428 PGIGSPTNCDPGSPSIRDKSISFG--YGLEMAARPTTCI--------GIAGDTSTDKARRMFHEA 482
Fly 483 RKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFAD--EG 545
Fly 546 DEDALETLRNCKTE 559 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cnk | NP_001286524.1 | SAM_CNK1,2,3-suppressor | 6..74 | CDD:188910 | 27/67 (40%) |
| SAM | 7..74 | CDD:197735 | 27/66 (41%) | ||
| CRIC_ras_sig | 82..165 | CDD:287501 | 18/90 (20%) | ||
| PDZ_signaling | 206..283 | CDD:238492 | 33/76 (43%) | ||
| PH | 720..814 | CDD:278594 | |||
| PH_CNK_insect-like | 720..810 | CDD:270135 | |||
| cnksr3 | NP_001135662.1 | SAM_CNK1,2,3-suppressor | 4..72 | CDD:188910 | 27/67 (40%) |
| CRIC_ras_sig | 80..172 | CDD:371119 | 18/93 (19%) | ||
| PDZ_signaling | 218..290 | CDD:238492 | 33/72 (46%) | ||
| DUF1170 | 332..501 | CDD:369026 | 44/203 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 77 | 1.000 | Domainoid score | I8694 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 261 | 1.000 | Inparanoid score | I3021 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1121556at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001221 | |
| OrthoInspector | 1 | 1.000 | - | - | otm49316 | |
| Panther | 1 | 1.100 | - | - | O | PTHR12844 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3250 |
| SonicParanoid | 1 | 1.000 | - | - | X1572 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 8.190 | |||||