DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr3

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001135662.1 Gene:cnksr3 XenbaseID:XB-GENE-5872973 Length:551 Species:Xenopus tropicalis

Alignment Length:599 Identity:155/600 (26%)
Similarity:260/600 (43%) Gaps:112/600 (19%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :.:|:|.||.:|:||||:.:..|:....:::|.|..||.....:|:.||:.:|.|||:|||||:.
 Frog     4 VTKWSPIQVVEWMKGLDDCLLQYVTNVEREKINGEQLLKFTHQDLQELGITQIQHQELVLEAVDL 68

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILH--------DITRTIATLK 127
            |...:|.|:.|:::...|.:.:::.||...:. |..:|...|:...|        .....|.:.|
 Frog    69 LCALNYGLEMDSMKNTVLKLRSSSNNLQNYIG-NQKKSASYDSNTSHKPHNDFLTSAVELIGSAK 132

  Fly   128 PLVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVP-AIRQSAERLENLANFVIQ 191
            .|:..|||.||.:..........:::..|:|.|...:: |:::.|. .:...::.|.::.:..|:
 Frog   133 ALLTCLERAPFTEITDLSSTKNKIIQLCLDLTTTVQQE-FSVEEVENTVLTVSKELNDICDKTIR 196

  Fly   192 DISDPMVLQPASL---NLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQ 253
            ..|||:....|.|   ::..:|..|. ||..|:|:|||:|.:|....||.|..|||:..|||::|
 Frog   197 LASDPLASHCACLEEVHMTNIKPGEG-LGMYIKSTYNGLHVITGTTENSAADRSGKVHAGDEVIQ 260

  Fly   254 INYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMP 318
            :||.||||||.:.::..||:....|.|.:||||..:..|         .|:..:|:  ||..|: 
 Frog   261 VNYHTVVGWQLKNLVARLRDNSGAVTLLLKKRPTSSLNF---------TPAPLKNL--RWRPQL- 313

  Fly   319 SPRAAFLTLDTEQLATGGTGSAVPDP----SKSLSSEKREVLTKANPVSSASDSDSSCSDIPTPT 379
                         :.|..:.:|:..|    :.||..||..:|....|              |.|:
 Frog   314 -------------VQTSHSPTAMQSPESTSNSSLKKEKPAILDLYIP--------------PPPS 351

  Fly   380 DPKLAAREI------RLYYP--------KPRALL---QRRNTICGCEYLSLKNSDLVVPSWHERK 427
            .|.....|:      |..||        .|.:.|   .||      .:.::.|||.:        
 Frog   352 VPYFPRTEVGSSGSNRCVYPIPGSEGSESPNSFLDHESRR------RWFTIANSDQL-------- 402

  Fly   428 PGIGSPTNCDPGSPSIRDKSISFG--YGLEMAARPTTCI--------GIAGDTSTDKARRMFHEA 482
              ..||.........:|||:.|:|  ..|.|.|.|:..:        .:||........|.|.. 
 Frog   403 --FSSPLEVKVQPAKLRDKTPSYGKPRPLSMPAEPSWMVPPETYSRHRLAGKKGEGVLSRYFSN- 464

  Fly   483 RKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFAD--EG 545
            .::..:||::... ..:..||...::||   ..|||..:...:    |..|.....:|:.:  |.
 Frog   465 EQITPITEENIYS-CSNLTKPASRRLVR---GADYVRASPSLL----NMDLHNSSTMPYQEDVEK 521

  Fly   546 DEDALETLRNCKTE 559
            ..:|..:.:|..||
 Frog   522 KHNASSSSKNSSTE 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 27/68 (40%)
SAM 7..74 CDD:197735 27/67 (40%)
CRIC_ras_sig 82..165 CDD:287501 18/91 (20%)
PDZ_signaling 206..283 CDD:238492 33/77 (43%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
cnksr3NP_001135662.1 SAM_CNK1,2,3-suppressor 4..72 CDD:188910 27/68 (40%)
SAM 4..69 CDD:197735 26/65 (40%)
CRIC_ras_sig 80..172 CDD:287501 19/94 (20%)
PDZ_signaling 218..290 CDD:238492 33/73 (45%)
DUF1170 334..541 CDD:284152 51/242 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61888820
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.