DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr1

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001116896.1 Gene:cnksr1 XenbaseID:XB-GENE-493182 Length:878 Species:Xenopus tropicalis

Alignment Length:1087 Identity:244/1088 (22%)
Similarity:389/1088 (36%) Gaps:296/1088 (27%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            ::.|:|:.|.::::|||.:::  :|.|.:..:.|:.||.:...:|:.||:..||||||:|||:|.
 Frog     4 VSSWSPETVRNYLRGLDPAVQ--VYTFQEWNVTGKDLLCLSSQQLDALGVRCIGHQEIILEAIEQ 66

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNL--H----RELARNHAESTKIDTRILHDITRTIATLKPL 129
            |...||.|..:||:.:...:...:::|  |    |::| :|:.|.....:.|..|...:|..:.|
 Frog    67 LCALHYELHAENLRSLTEKLYGVSQSLWSHILSMRKVA-SHSLSAAPTPKQLVCIIDIVAAARGL 130

  Fly   130 VGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRD----RFALQPVPAIRQSAERLENLANFVI 190
            ...|.|..|.:...|......::.| ||||...|:|    ....:.|...:......|::.|...
 Frog   131 FSWLNRYLFARLNDYSASRDVIVLC-LELAESVHKDWSDPHVESRVVSICQNICGTCESILNCSP 194

  Fly   191 QDISDPMVLQPASLNLVTLKKR--ESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQ 253
            :|:.:    |.|:|..|.:|..  ...||..|:|:..|.|.|......:||..||||..||||::
 Frog   195 EDLLN----QTATLEPVLIKPELPHYNLGIEIKSTSLGQHFVCGTTAEAPAGRSGKIFPGDEIIK 255

  Fly   254 INYQTVVGWQHRTVLEHLREALPDVVLTVKK--------RPKHTKMFGQIYMQPYRLPSKKRNMA 310
            :|.|.||||..:.::..|:|....|.|.:||        .|.....|.|        .|.|..:.
 Frog   256 VNDQVVVGWTRKNLVYKLQEKTDCVTLVLKKVSIPSTSVSPTSPTYFIQ--------HSSKTTLT 312

  Fly   311 ARWAAQMP----SPRAAFLTLDTEQLATGGTGSAVPDPSKSL-----SSEKREVLTKANPVSSAS 366
            |.....:|    :|.||                |...||..:     |:|.|  .|::.||:...
 Frog   313 AHSEPSLPKAEITPVAA----------------ARQSPSHLILALRKSTETR--TTRSAPVTPTK 359

  Fly   367 DSDSSCSDIPTPTDPKLAAREIRLYYPKPRALLQRRNT-ICGCEYLSLKNSDLVVPSWHERKPGI 430
            |:.|..:.....|.|         .:....:...:.|| |...:..|.:|||.::.:        
 Frog   360 DTPSVLNLNSVSTSP---------VFSDKFSFTNKHNTDISQNQDSSQQNSDTILSA-------- 407

  Fly   431 GSPTNCDPGSPSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQRE 495
                || |.||:                                    |.|:..:..|:..|...
 Frog   408 ----NC-PWSPT------------------------------------FWESTSVFPLSPLSPEN 431

  Fly   496 FLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIPFADEGDEDALETLRNCKTEN 560
            |                                                 |:...||        
 Frog   432 F-------------------------------------------------DQKTKET-------- 439

  Fly   561 AEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSHSTPAYDNSGEESDTPPAIEPRKEFL 625
                          :.||:.||..:...|...|.|            ||.:|.|.|...|....|
 Frog   440 --------------KALPITEADTLQNTQCMSRPR------------SGSDSFTTPTASPFSATL 478

  Fly   626 LVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPASSITSISIPVPVPVPAAVDPSEISELHTPS 690
            ......|.......:..|.|||.|.|..|..:...|             |:..|.:.:|:....:
 Frog   479 FAGLLRPALSDSNLKASTDPAVLPQPNVPKEVTAKS-------------PSIKDDNLVSKSPQTA 530

  Fly   691 KSRTLTLKKKHSLMAK---------------------RRNTNLKLLGTGDIQGHLYRRKKNHRGV 734
            ||..:|:.|.:|...:                     ||..:.:.||..|..|.|.::|:|...:
 Frog   531 KSPQVTVTKTNSKQTQHGKEKSPGARRKKKGVATKLSRRRVSCRDLGNPDCDGWLTKKKENAGFM 595

  Fly   735 TY-WARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPHAFKVYH-TAKSFYFAA 797
            |. |.|.:.|:....||.:...|...|..::.:..:.:..|:| ..|.:.|::.| |.|.|.|||
 Frog   596 TQKWKRCWCVLKGDRLYWYNVPQDEKALGLVNISSYKLESARE-PKKKYEFQLCHPTYKPFVFAA 659

  Fly   798 ESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSENDSSGEECDALVIQN-LSTPSPQGNKE 861
            :||..|:.||..| .|:|.:..:..|......:|.|||.::...:.|....|. :.||......:
 Frog   660 DSLSDLSSWVTSL-LAALNIHKTASSATQAHEEDCYSETEAEDLDEDHSKTQEVVKTPLTHVQSQ 723

  Fly   862 SMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSSAAKPSSDIPVPTEQYRSYRKVPGGSF 926
            ::|.|.|.|..:..|      |.|.:         .|.|..:|::|   ..|...|..:..|.|.
 Frog   724 NISSSPTTSEESNTS------ESGQI---------LKESDVQPAND---TLESLISCLQQGGVSL 770

  Fly   927 GIQIGANT-----------------PGYHDPAMPPTQIPPLVGPKLSRSSSRSSVVSGTESAVSL 974
               |||.|                 |..:..|.....:...:..||....:.:.::...    ||
 Frog   771 ---IGAKTVLTRDDYRKSFVRRNKNPEINQKAHALRALQSTLKAKLLELEALNQILENP----SL 828

  Fly   975 SASI----------LGPPASPAPTPTPTATPTSLQHQSSEESPSQSQ 1011
            |::|          |.......|.|..|...|.....||.|...|::
 Frog   829 SSAIFQKWKSDHGQLYETLGRGPKPRSTVVDTWAHTDSSGEEKEQAE 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 25/68 (37%)
SAM 7..74 CDD:197735 25/67 (37%)
CRIC_ras_sig 82..165 CDD:287501 22/89 (25%)
PDZ_signaling 206..283 CDD:238492 29/79 (37%)
PH 720..814 CDD:278594 30/96 (31%)
PH_CNK_insect-like 720..810 CDD:270135 28/92 (30%)
cnksr1NP_001116896.1 SAM_CNK1,2,3-suppressor 4..70 CDD:188910 25/68 (37%)
SAM 4..67 CDD:197735 24/65 (37%)
CRIC_ras_sig 78..167 CDD:287501 23/91 (25%)
PDZ 205..285 CDD:214570 29/80 (36%)
PH_CNK_mammalian-like 567..680 CDD:269962 36/115 (31%)
PH 581..676 CDD:278594 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62005549
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.800

Return to query results.
Submit another query.