DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr2

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:XP_012811699.1 Gene:cnksr2 XenbaseID:XB-GENE-490704 Length:1068 Species:Xenopus tropicalis

Alignment Length:1255 Identity:298/1256 (24%)
Similarity:472/1256 (38%) Gaps:350/1256 (28%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            :::|||.||.||:||||:.::.|:..|.:::|.|..||.|...|||.||:.||||||::||||:.
 Frog     8 VSKWTPSQVVDWMKGLDDCLQQYIKNFEREKIAGDQLLRITHQELEELGVTRIGHQELILEAVDL 72

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHRELA----RNHAE---STKIDTRILHDITRTIATLKP 128
            |...:|.|:.:||:.::..:.::||||...:.    ..|.:   |.|:....|..:...|.:.|.
 Frog    73 LCALNYGLETENLKTLSHKLNSSAKNLQNFITGRRRSGHYDGKSSRKLPNDFLTSVVDLIGSAKS 137

  Fly   129 LVG-----------------------SLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQ 170
            |:.                       .|:::||.....|.....||::..|||.||..::....:
 Frog   138 LLAWLDRYCHADQDDIDNLKKRWIGHKLDKSPFAAVTDYSVTRNNVIQLCLELTTIVQQECTVYE 202

  Fly   171 PVPAIRQSAERLENLANFVIQDISDPMVLQPASLNLVTLK--KRESELGFNIESSYNGIHRVTDI 233
            ....|....:.|..:.:.:|...|||:|.|.|.|.::.|.  |....||..|:|:|:|:|.:|..
 Frog   203 TENKILHVCKTLSGVCDHIISLSSDPLVSQSAHLEVIQLSNIKPSEGLGMYIKSTYDGLHVITGT 267

  Fly   234 KYNSPAHNSGKIEDGDEIVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQ 298
            ..||||....||..|||::|:|:|||||||.:.::..|||....|:||:||||:....       
 Frog   268 TENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLT------- 325

  Fly   299 PYRLPSKKRNMAARWAAQMPSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKANPVS 363
              ..|:..:||  ||..      .|....|.|.              |:.|..:...|...:|.|
 Frog   326 --SAPALLKNM--RWKP------LALQWYDEEM--------------KTYSWTRISPLIPRSPTS 366

  Fly   364 SASDSDSSCSDIPTPTDPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVVPSWHERKP 428
            .|:...|:   |.|||....:|.:                             ||.:|       
 Frog   367 GAATPSST---ISTPTKRDSSALQ-----------------------------DLFIP------- 392

  Fly   429 GIGSPTNCDPGSPSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFHEARKLKQLTEDSQ 493
                |...:|..|  ||:.                    |:...:...|  |...|......:|.
 Frog   393 ----PPPPEPYIP--RDEK--------------------GNLPCEDMTR--HTVGKPVSKGSESP 429

  Fly   494 REFLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFE--------------------- 537
            ..||...|:.      .|:..|             |:.||..:|                     
 Frog   430 NSFLDQEYRK------HFNVVE-------------EDAILYCYEYDKGRSGMQGRRESTPTYGKL 475

  Fly   538 -----PIPFADEGD-EDALETLRNCKTENAEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRL 596
                 |:.:...|| ||..:..|:.:.|::  ||..|:     .|..:.|..   :||:|.:...
 Frog   476 RPISMPVEYNWVGDYEDPNKIKRDSRRESS--LLRYIS-----NDKVIQEEY---MLQRGTKKET 530

  Fly   597 DKSHSTPAYDNSGEESDTPPAIEPRKEFLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPAS 661
            .|...     ..||::.:|      ..:.|:                               ||.
 Frog   531 GKKSK-----KKGEKNTSP------SHYALI-------------------------------PAV 553

  Fly   662 SITSISIPVPVPVPAAVDPSEISELHTPSKSRTLTLKKKHSL-----MAKRRNTNLKLLGTGDIQ 721
            .:.|:...|..|     ..|:.:..||..:|......||.:.     .:||| .:.|.||.||.:
 Frog   554 QMDSLCHEVVSP-----SVSDAASYHTFQQSSLQHKSKKRNKGPVPGKSKRR-ISCKDLGRGDCE 612

  Fly   722 GHLYRRKKNHRGVTY----WARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSKPH 782
            |.|:::|.   ..:|    |.:.:|::.||.||.:.:::...|...|.||.|.:..|.|...| .
 Frog   613 GWLWKKKD---AKSYFSQKWKKYWFILKDTSLYWYINEEEEKAEGFISLPEFKIDRASECRKK-F 673

  Fly   783 AFKVYH-TAKSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSENDSSGEECDAL 846
            |||..| ..|||||||::||.:|:|:..:..|..........|....:.:.:||:|.  ||.|..
 Frog   674 AFKACHPKIKSFYFAADNLDDMNRWLSRVNLAVSSYAERERIKQDQGSINYWSESDQ--EEVDTP 736

  Fly   847 VIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTN--TFKSSAAKPSSDIP 909
            ......:|.|..:......||:.:.   |...| ||.....::.:..::  .|:..||..::|.|
 Frog   737 STPKQDSPPPPYDTYPRPASMSCAS---PFVEP-KHRLSSTETSQSHSSHEEFRQEAAGSTTDSP 797

  Fly   910 V--PTEQYRSYR---KVPGGSFGIQIGANTPGYHDPAMPPTQIPP-------LVGPKL------- 955
            |  ...|.||::   :.|..|.|:......|......:.|..:.|       |..||.       
 Frog   798 VRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFLEPAVVSPDHRRQSTLPAPKCHLLDHYG 862

  Fly   956 ---------SRSSSRS------------------------SVVSGTESAVSLSASILGPPASPAP 987
                     |::.|.|                        |::...||::.|...  |...|..|
 Frog   863 PFSLAECKQSQAQSGSGAKPRSFTLPRDGGLSHCAPLSPVSILEPLESSLKLETQ--GEAKSDQP 925

  Fly   988 TPTPTATPTSLQHQSSEESPSQS----------QSQSP------SSKSSLKKAPFNFLHASNPNL 1036
            .....||.|      .:|.|:.|          .|.||      |:|...||   :|:...:..:
 Frog   926 GKVEDATET------VDEKPADSLQDLYRALEQASLSPLGDRRLSTKVEYKK---SFIKRCSDPV 981

  Fly  1037 VEFDFHTSKTLLPKMSVGNTLDHGHNIQGFVTLKDLMLRKQE---EEAQEMYNNRVHLGVE---K 1095
            |....|..:.|...:...         :|.|.:.|.:|.|.:   ::.||..:..:.|.:|   |
 Frog   982 VNEKLHRLRILKSTLKAK---------EGEVAIIDKLLEKPDFTSKDFQEWKSLYLELFLEICQK 1037

  Fly  1096 HKHARTESTASQQSAMSSSV 1115
            ......||.:|:..|:..|:
 Frog  1038 SNSKDGESVSSEVDALIQSL 1057

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 34/68 (50%)
SAM 7..74 CDD:197735 34/67 (51%)
CRIC_ras_sig 82..165 CDD:287501 24/113 (21%)
PDZ_signaling 206..283 CDD:238492 34/79 (43%)
PH 720..814 CDD:278594 34/99 (34%)
PH_CNK_insect-like 720..810 CDD:270135 33/95 (35%)
cnksr2XP_012811699.1 SAM_CNK1,2,3-suppressor 8..76 CDD:188910 34/68 (50%)
SAM 8..73 CDD:197735 33/65 (51%)
CRIC_ras_sig 84..199 CDD:287501 24/115 (21%)
PDZ_signaling 245..317 CDD:238492 33/72 (46%)
DUF1170 379..599 CDD:284152 56/360 (16%)
PH_CNK_mammalian-like 597..710 CDD:269962 42/118 (36%)
PH 611..707 CDD:278594 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61945914
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.