DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cnk and cnksr3

Sequence 1:NP_001286524.1 Gene:cnk FlyBaseID:FBgn0286070 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001107119.1 Gene:cnksr3 ZFINID:ZDB-GENE-080204-43 Length:546 Species:Danio rerio

Alignment Length:543 Identity:145/544 (27%)
Similarity:228/544 (42%) Gaps:118/544 (22%)


  Fly     6 IAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVEN 70
            |.:||..||.|||:|||:|::.|:..|.:::|.|..||.|...|||.|.:.|:||||::||||:.
Zfish     4 ITKWTAAQVVDWIRGLDDSLQQYISNFEREKISGERLLKISHQELEELSVTRVGHQELILEAVDL 68

  Fly    71 LRNFHYHLKNDNLQFMALHVATAAKNLHR---ELARNHA----ESTKIDTRILHDITRTIATLKP 128
            |...:..::.|||:.:...:..|:.||..   |..:|.:    ...|.....|..:...|...|.
Zfish    69 LCALNCGVETDNLKTLVGQMRAASNNLQNCASERRKNPSYDGGSPNKPPNVFLTAVVELIGAAKS 133

  Fly   129 LVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDI 193
            ::..|:|:|......:......:::..|||.|...:|....:....|.:.::.|..:.:..::..
Zfish   134 MLAWLDRSPLTGVSDFTTTKNKIIQLCLELTTTVQKDCTVFEMEEKILEVSQVLTGICDSTMRMT 198

  Fly   194 SDPMVLQPASLNLVTLK--KRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINY 256
            |||:..|...|..|.:.  |....||..|:|:|:|:|.:|....||||..:.:|..|||::|:|.
Zfish   199 SDPLKTQVTCLEEVPISNIKPGEGLGMYIKSTYDGLHVITGTTENSPADRTQRIHAGDEVIQVNK 263

  Fly   257 QTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNM------------ 309
            |||||||.:.::|.|||...:|.|.|||||..|..|         .|:..:||            
Zfish   264 QTVVGWQLKNLVEKLREDPQNVTLMVKKRPSGTCSF---------TPAPLKNMRWRPPVIQSPSF 319

  Fly   310 -----AARWAAQM----------------PSPRAAFLTLDTEQLATGGT-----GSAVPDPSKSL 348
                 ::|...||                |.|...:...|.|:....|.     ||..|:.|..|
Zfish   320 VPATQSSRHPVQMSIRRPEKPAILDLYIPPPPSVPYSPRDAEKSEYAGVKMRPKGSESPNSSLDL 384

  Fly   349 SSEKREVLT----------------------------KANPVSSASDSDSSCSDIPTPTDPKLAA 385
            ::.:|..::                            |..|||...|:....||  :|:.|....
Zfish   385 ANRRRSNISDYNNKPTVQPAEAAVPQARMRQRTPSRGKPRPVSMPVDTCLGMSD--SPSRPWALG 447

  Fly   386 RE----IRLY---------------YPKPRALLQRRNTICGCEYL----SLKNSDL----VVPSW 423
            |:    :..|               ||.|......|..:.|.:::    ...|:||    .:| :
Zfish   448 RKGDELLHRYLSNEQIPTISEESPCYPLPYRPAGERQLVRGVDHIRGSQCFINADLHNSATIP-Y 511

  Fly   424 HE---RKPGIGSPTNCDPGSPSI 443
            .|   |||...| :...|..||:
Zfish   512 QEAVARKPASKS-SKRPPSEPSV 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cnkNP_001286524.1 SAM_CNK1,2,3-suppressor 6..74 CDD:188910 33/68 (49%)
SAM 7..74 CDD:197735 32/67 (48%)
CRIC_ras_sig 82..165 CDD:287501 18/90 (20%)
PDZ_signaling 206..283 CDD:238492 34/79 (43%)
PH 720..814 CDD:278594
PH_CNK_insect-like 720..810 CDD:270135
cnksr3NP_001107119.1 SAM_CNK1,2,3-suppressor 4..72 CDD:188910 33/68 (49%)
SAM 6..69 CDD:197735 31/63 (49%)
CRIC_ras_sig 80..172 CDD:287501 19/92 (21%)
PDZ_signaling 218..290 CDD:238492 33/72 (46%)
DUF1170 336..536 CDD:284152 39/203 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61889975
eggNOG 1 0.900 E1_KOG1738
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1121556at2759
OrthoFinder 1 1.000 FOG0000782
OrthoInspector 1 1.000 T596824
orthoMCL 1 0.900 OOG5_130611
Panther 1 1.100 O PTHR12844
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3250
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.