DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and prc

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_524658.2 Gene:prc FlyBaseID:FBgn0028573 Length:1713 Species:Drosophila melanogaster

Alignment Length:436 Identity:127/437 (29%)
Similarity:154/437 (35%) Gaps:124/437 (28%)


  Fly    18 ISGQWTSARP---QNPYYVENGGHGYPNHHRHHGHHVHGSGYGPGSIGPPPFVFGRFPPPPSYYP 79
            |.||..:.:|   ..|......|.|.|.:....|.... :|.|....|..|.:.|:         
  Fly   474 IGGQTGAGQPGYGSQPGVGAQTGAGQPGYGAQPGVGAQ-TGAGQPGYGSQPGIGGQ--------- 528

  Fly    80 DNQPSGGRQPYY---PNVGAV--QGQPGSQFH-----QHGGGFHRGQQEYPYPVGDFNRGHPGL- 133
                :|..||.|   |.|||.  .||||....     |.|.| ..|....|...|....|.||. 
  Fly   529 ----TGAGQPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAG-QPGYGSQPGIGGQTGAGQPGYG 588

  Fly   134 QQP--GGDFNRGQPGF-QQP--GNEFNRPQPS-GRAPGH-------QQSGSHEELPTYPRGLEP- 184
            .||  |.....||||: .||  |.:....||. |..||:       .|:|:.:  |.|  |.:| 
  Fly   589 TQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTGQ--PGY--GAQPG 649

  Fly   185 -------------QQP--GGDPNTLQPRPGQNPG-----GFEQPNENAGGFQQSGQNNGGFRQPS 229
                         .||  ||.....||..|..||     |..||..   |.|..||...|  |||
  Fly   650 VGGQTGAGQPGYGTQPGIGGQTGAGQPGYGSQPGIGGQTGGGQPGY---GSQIGGQTGAG--QPS 709

  Fly   230 ---------QNSGGFQQPGQSTGGFQQP---GQSSGGFQQPGQSTGGFQQPGQSTGGFQQPGQST 282
                     ||..|  |||..|    ||   ||:..|  |||.  ||....|.|.|...|||  .
  Fly   710 YGSQPGVGAQNGAG--QPGYGT----QPVIGGQTGAG--QPGY--GGQTGVGGSPGFLTQPG--I 762

  Fly   283 GGFRQP-DQSSGGFQQPDQNSGEFQQPGL----NQGRKPGTSNNSIQPRPGSADEDFSDFNFQSP 342
            ||...| ....||.|......|.:.|||:    ..|.:||     |..:.|:....:..      
  Fly   763 GGISGPIGGKLGGGQSEAAKPGYWAQPGIGGPSRYGSQPG-----IGDQTGTGQSGYGG------ 816

  Fly   343 KTLQPRPGQDYETAGS----GGAQTIQPIPGH---PQSSVIQPIPG 381
                 :||...:|.|.    ||..||..:||:   |....:..:||
  Fly   817 -----QPGISGQTGGGQPGYGGQATISGLPGYGTQPGIGALTAVPG 857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605 62/226 (27%)
PTZ00395 <124..>428 CDD:185594 96/318 (30%)
prcNP_524658.2 Pericardin_rpt 159..191 CDD:284468
Pericardin_rpt 176..208 CDD:284468
Loricrin 216..534 CDD:292475 16/74 (22%)
Pericardin_rpt 227..259 CDD:284468
Pericardin_rpt 244..276 CDD:284468
Pericardin_rpt 295..326 CDD:284468
Pericardin_rpt 312..344 CDD:284468
Pericardin_rpt 346..378 CDD:284468
Pericardin_rpt 363..395 CDD:284468
Pericardin_rpt 397..429 CDD:284468
Pericardin_rpt 431..463 CDD:284468
Pericardin_rpt 465..497 CDD:284468 6/23 (26%)
Pericardin_rpt 482..514 CDD:284468 7/33 (21%)
Pericardin_rpt 516..547 CDD:284468 11/44 (25%)
Pericardin_rpt 533..565 CDD:284468 13/32 (41%)
Pericardin_rpt 567..598 CDD:284468 9/31 (29%)
Pericardin_rpt 584..616 CDD:284468 12/32 (38%)
Pericardin_rpt 624..656 CDD:284468 8/36 (22%)
Pericardin_rpt 641..673 CDD:284468 8/36 (22%)
Pericardin_rpt 841..873 CDD:284468 5/18 (28%)
Pericardin_rpt 893..929 CDD:284468
Glutenin_hmw 925..>1382 CDD:281191
Pericardin_rpt 948..992 CDD:284468
Pericardin_rpt 977..1009 CDD:284468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.