DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and SATL1

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001354786.1 Gene:SATL1 HGNCID:27992 Length:695 Species:Homo sapiens

Alignment Length:459 Identity:112/460 (24%)
Similarity:151/460 (33%) Gaps:148/460 (32%)


  Fly    80 DNQPSGGRQPYYPNVGAVQ--------GQPGSQFHQHGGGFHRGQQEYPYPVGDFNRGHPGLQQP 136
            |:| |||.||....||..|        .|||:        :..|..:            |.|:||
Human   143 DSQ-SGGSQPSMRQVGTSQLGTSQIGMSQPGT--------WQTGLSQ------------PVLRQP 186

  Fly   137 GGDFNRGQPGFQQPGNEFNRPQPSGRAPGH---QQSGSHEELPTYPRGLEP------------QQ 186
                |...||..|||  ..:|..|.:.|.|   .|.|..:::|:.|...:|            .|
Human   187 ----NMSPPGMWQPG--VQQPGISQQVPSHPDMSQPGMSQQVPSQPGIRQPDTSQSCKNQTDMSQ 245

  Fly   187 PGGDPNTL---------QPRPG------------------QNPGGFEQPNENAGGFQQSGQNNGG 224
            |..:.::|         ||.|.                  .|....:||:.:..|.:|||.|   
Human   246 PDANQSSLSDSNQTGIIQPSPSLLGMNQMDMNQWSASLYEMNQVDMKQPSMSQAGMRQSGTN--- 307

  Fly   225 FRQPSQNSGGFQQPGQSTGGFQQPGQ----------SSGGFQQPGQSTGGFQQPGQSTGGFQQPG 279
              .|..|..|.:|||....|..|||.          |.....|||.......|.|.......|.|
Human   308 --LPDINQPGMKQPGTWQLGRSQPGMWPQSLSELVLSEASISQPGPPQRAPSQSGPRQSSTSQAG 370

  Fly   280 QSTGGFRQP-----DQSSGGFQQPD------QNSGEFQ---------QPGLNQ--GRKPGTSNNS 322
            .:..|..||     |....|..||.      ..||..|         |.||:|  .|:|..|...
Human   371 TNQSGISQPVMWQLDMRQSGGSQPSMRQVGTSQSGTSQIGMSQPGTWQTGLSQPVPRQPNKSPPG 435

  Fly   323 IQPR----PGSADEDFSDFNFQSPKTLQPRPGQDYETAGSGGAQTIQPIPGHPQSSVIQPIPGRA 383
            :..|    ||.:.:..|....:.|.|.|           |...||....||..|..:.:|.|.:.
Human   436 MWQRGMWQPGMSQQVPSQLGMRQPGTSQ-----------SSKNQTGMSHPGRGQPGIWEPGPSQP 489

  Fly   384 QSSDNVDQNINDLFNTHDFLSPELSTAPGANRDPKSDAEEASPESVNQRSLFNLDPKCAEGLKLM 448
            ..|   .|::|.|          :.:.||.:: |.......|...:.|.|:.....:.||     
Human   490 GLS---QQDLNQL----------VLSQPGLSQ-PGRSQPSVSQMGMRQTSMDYFQIRHAE----- 535

  Fly   449 AGRC 452
            ||.|
Human   536 AGDC 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605 40/174 (23%)
PTZ00395 <124..>428 CDD:185594 91/382 (24%)
SATL1NP_001354786.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_156005
Panther 1 1.100 O PTHR10545
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.