DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and Satl1

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001157015.1 Gene:Satl1 RGDID:1565932 Length:758 Species:Rattus norvegicus

Alignment Length:569 Identity:130/570 (23%)
Similarity:171/570 (30%) Gaps:227/570 (40%)


  Fly    72 PPPPSYYPDNQPSGGRQPYYPNVGAVQGQPG-SQFHQHGGGFHRGQQEYPYPVG---DFNRGHPG 132
            ||.|..|...|| |..|||       ..||. :|...:..|..|       ||.   |.|:  ||
  Rat    23 PPGPGPYNMQQP-GPSQPY-------TSQPSMNQPSTNKPGVTR-------PVSCQLDINQ--PG 70

  Fly   133 L------------QQPG---------------------GDFNRGQP------GFQQPG------N 152
            |            .|||                     ...|..||      |..|||      .
  Rat    71 LGQSNIKQSWTSTNQPGIYKTDLSQQSMRESDPRQVGMKQLNSSQPAAMNQTGLWQPGPPTPNMK 135

  Fly   153 EFNR----PQPSGRAP-----------GHQQSGSHEELPTYPRGLEP----QQPG---------- 188
            :.|.    |:.|||.|           |.:||.:.::.|:|....:|    |.||          
  Rat   136 QINTWQWDPEYSGRGPPDMWQITQNNQGTKQSDTVQQDPSYAGQKQPDTWKQDPGMKETDLWQWG 200

  Fly   189 -GDPNTLQ--------PRPGQNPGGFEQPNENAG-----GFQQSGQNNGGFRQ-------PS--- 229
             ..|:..|        ..||.......||..|..     ..:|:...:.|.:|       ||   
  Rat   201 PSPPSMRQTDAWQWDPDHPGSKQSNSWQPQLNPSSPRQFNLRQASPTDQGMKQSDMCQPGPSQQG 265

  Fly   230 --QNSGGFQQPGQS--------TGGFQQPGQSSGGFQQPGQSTGGFQQPGQSTGGFQQP------ 278
              |:|.|.|.|||.        ..|..:.|:...|..|.|.:..|.:|......||.||      
  Rat   266 NRQSSTGQQSPGQQCTRHSVTWQAGPSEEGKKLSGAWQVGLNHSGMEQFNTCQTGFSQPYNMCQL 330

  Fly   279 GQSTGGFRQPDQSSGGFQQPDQNSGEFQQPGLNQ-GRK---------------------PGTSNN 321
            |.|....::.|....|..|||....:..|.|.:| |.|                     ||.|..
  Rat   331 GPSQSSMKELDMWQSGSSQPDMKDLDVWQSGTSQPGMKQMDPWQWNPNYLVKTQSDKWPPGPSPL 395

  Fly   322 SIQP----RPGSADEDFSDFNFQSPKTLQPRPG-----------------------QDYETAGSG 359
            .|:.    :||.:...:||.....|.    |||                       |:|...|..
  Rat   396 DIRQLDSWQPGQSGMKYSDSGPWDPS----RPGMIHSDLWHPSLSQLGTRQFDTWPQNYNMPGVR 456

  Fly   360 GAQTIQPIPGHP---QSSVIQPIPGRA--QSSDN-----------------VDQN------INDL 396
            ...|..|.|.:.   ||...|..||..  :.|||                 :|.|      .|..
  Rat   457 QLYTWHPTPSYSSTRQSEKWQIYPGNTNMKQSDNWETVPRQSGTTQLGTNQLDTNQPDGTKSNQG 521

  Fly   397 FNTHDFLS------PELSTAPGANRDPKSDAEEASPESVNQRSLFNLDP 439
            ..||...|      |||:   |::.|  :...:.|...::|.....|:|
  Rat   522 VKTHSVKSEPSPSKPELT---GSSLD--TSQSDLSQLGISQPGKSQLEP 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605 51/219 (23%)
PTZ00395 <124..>428 CDD:185594 110/504 (22%)
Satl1NP_001157015.1 RimI 594..731 CDD:223532
Acetyltransf_1 657..731 CDD:278980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_156005
Panther 1 1.100 O PTHR10545
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.