DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and ats1

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_593494.1 Gene:ats1 PomBaseID:SPAC1002.07c Length:168 Species:Schizosaccharomyces pombe

Alignment Length:31 Identity:8/32 (25%)
Similarity:15/32 (47%) Gaps:2/32 (6%)


  Fly   353 YETAGSG--GAQTIQPIPGHPQSSVIQPIPG 381
            ||.||:.  |..::..:.|....::...:||
pombe   136 YEKAGAQKVGGWSMMRVTGENLKALADKLPG 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605
PTZ00395 <124..>428 CDD:185594 8/32 (25%)
ats1NP_593494.1 Acetyltransf_3 4..142 CDD:290041 4/6 (67%)
Acetyltransf_1 61..142 CDD:278980 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10545
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.