DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and Qrich2

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_011247256.1 Gene:Qrich2 MGIID:2684912 Length:2337 Species:Mus musculus

Alignment Length:481 Identity:117/482 (24%)
Similarity:154/482 (32%) Gaps:161/482 (33%)


  Fly    58 PGSIGPPPFVFGRFPP----PPSYYPDNQPSGGRQPYYPNVGAVQ---GQPGSQFHQHG----GG 111
            ||.:.|     |...|    |.|..|.....|..||.....||||   .|||:.  :.|    |.
Mouse   881 PGMVHP-----GAAQPGMVQPGSVQPGMVQLGAVQPGVLQAGAVQFGMVQPGAV--EPGVLRAGA 938

  Fly   112 FHRGQ-QEYPYPVGDFNRG--HPGLQQPG----GDFNRG-------QPGFQQPGNEFNRP-QPSG 161
            ...|. |.....:|.|..|  .||:.|.|    |...:|       |.|..|||.....| ||..
Mouse   939 VQLGMVQPGAVQLGVFRAGAVQPGVLQAGAVQPGMVQQGPVQPGVLQAGAVQPGMVQQGPVQPGV 1003

  Fly   162 RAPGHQQSGSHEELPTYPRGLE------------PQQPGG-DPNTLQP---RPGQNPGGFEQPNE 210
            ...|..|.|..::.|..|..|:            |.|||. ....:||   :||..|.|:.||..
Mouse  1004 LQAGAVQPGMVQQGPVQPGVLQAGAVQPGMVQQGPVQPGVLQSGAVQPGMVQPGILPSGWGQPVA 1068

  Fly   211 NAGGFQQSGQNNGGFRQPSQNSGGFQQPGQSTG-------------------------------- 243
            .:.|..|.|....|..||..:..||.|||.:.|                                
Mouse  1069 YSLGLGQPGIGQYGLVQPRVDRYGFVQPGVARGLLQPSDSQRALMQPGVGQVEWIQPGMSRRDLV 1133

  Fly   244 ---------------------------GFQQPGQSSGGFQQPGQSTGGFQQPGQSTGGFQQPGQS 281
                                       |..|||.:..|...||.:..|...||::..|...||::
Mouse  1134 QPGADESGLAQGGMAQQGLVQSGMARQGLAQPGMARQGVAHPGMARQGVAHPGKARQGVAHPGKA 1198

  Fly   282 TGGFRQPD--------QSSGGFQQPDQNSGEFQQPGLNQGRKPGTSNNSIQPRP---GSADEDFS 335
            ..|..|||        :...|..||..:...|.|||::|       ...:|||.   |..|....
Mouse  1199 RQGVAQPDLAQPGAPSEDKFGLAQPIVDQSAFMQPGMDQ-------RGLVQPRMYQYGFVDPSDL 1256

  Fly   336 DFNFQSPKTLQPRPGQDYETAGSGGAQTIQPI--------PGHPQSSVIQPI------------- 379
            ..||..|:.:.||              .:||:        .|..||.::|||             
Mouse  1257 QRNFLQPRGVLPR--------------LVQPVVDQGGPLQAGLAQSRMVQPITDQRGPVQPETLQ 1307

  Fly   380 PGRAQSSDNVDQNINDLFNTHDFLSP 405
            |.:.|.|.:....:..|...:..:.|
Mouse  1308 PRQVQPSTSRRGLVQSLLTPYGLMQP 1333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605 54/188 (29%)
PTZ00395 <124..>428 CDD:185594 95/404 (24%)
Qrich2XP_011247256.1 Glutenin_hmw 320..1082 CDD:281191 60/208 (29%)
Glutenin_hmw 796..1414 CDD:281191 117/482 (24%)
DUF4795 1842..2022 CDD:292662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R15764
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.