DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and LOC102550872

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_008766660.1 Gene:LOC102550872 RGDID:7609480 Length:219 Species:Rattus norvegicus

Alignment Length:43 Identity:13/44 (30%)
Similarity:17/44 (39%) Gaps:6/44 (14%)


  Fly   401 DFLSPELSTAPGANRDPKSDAEEASPESVNQRSLFNLDPKCAE 443
            ||..|  ||..|.:.:....|...|.....:|||    ||..:
  Rat    52 DFHYP--STESGRSVELSHSAPHVSTSKEKRRSL----PKLTQ 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605
PTZ00395 <124..>428 CDD:185594 8/27 (30%)
LOC102550872XP_008766660.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.