DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbp2 and qrich2

Sequence 1:NP_001286521.1 Gene:Gbp2 FlyBaseID:FBgn0034200 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_002935980.2 Gene:qrich2 XenbaseID:XB-GENE-1003760 Length:941 Species:Xenopus tropicalis

Alignment Length:209 Identity:47/210 (22%)
Similarity:68/210 (32%) Gaps:55/210 (26%)


  Fly   174 ELPTYPRGLEPQQPGGDPNTLQPRPGQNPGGFEQPNENA-----GGFQQSGQNNGGFRQPSQNSG 233
            |:|  |:|..||.      |:...|.:.|...|.|::.|     |   .:.|..||...| |.:.
 Frog   315 EVP--PQGHVPQV------TVVSPPCEEPSLAEGPSQAALDPLLG---PASQTEGGALSP-QTAV 367

  Fly   234 GFQQPGQSTGGFQQPGQSSGGFQQPGQSTGGFQQPGQSTGGFQQPGQSTGGFRQPDQSSGGFQQP 298
            .||.       ||:..|.|.|.  |....||...|..:.    .|..||   ..|.....|    
 Frog   368 SFQT-------FQEGLQFSTGL--PSTPPGGPVPPCSAV----NPSVST---HPPGSPMVG---- 412

  Fly   299 DQNSGEFQQPGLNQGRKPGTS--NNSIQPRPGSADEDFSDFNFQSPKTLQPRPGQDYETAGSGG- 360
                    .|.....:.||.:  ...:..:|.:.....::.:.|...|.||..|.......|.| 
 Frog   413 --------PPSTTPAQLPGVTFVPEQLTDQPNNPAAITTEISSQIASTSQPITGATIPVVPSNGN 469

  Fly   361 -------AQTIQPI 367
                   |.|::.:
 Frog   470 SRASQRYADTVEAL 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbp2NP_001286521.1 dnaA 26..>204 CDD:237605 9/30 (30%)
PTZ00395 <124..>428 CDD:185594 47/210 (22%)
qrich2XP_002935980.2 PHA02682 <318..521 CDD:177464 45/205 (22%)
DUF4795 552..728 CDD:292662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002037
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.