DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Amy-d and AMY1

Sequence 1:NP_523768.1 Gene:Amy-d FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_567714.1 Gene:AMY1 AraportID:AT4G25000 Length:423 Species:Arabidopsis thaliana

Alignment Length:359 Identity:78/360 (22%)
Similarity:137/360 (38%) Gaps:103/360 (29%)


  Fly    35 FEWK-W--------------DDIAAECENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS-Y 83
            |.|: |              ||||..        |...:.:.|.:::...      |.|.|.. |
plant    32 FNWESWKKEGGFYNSLHNSIDDIANA--------GITHLWLPPPSQSVAP------EGYLPGKLY 82

  Fly    84 KL-ETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAAD------GGTYGTGGSTASPSSKSYPG 141
            .| .::.|:|.:..|::|..|..|::...|:|.||..|:      |..|..||::.         
plant    83 DLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTAERKDDKCGYCYFEGGTSD--------- 138

  Fly   142 VPYSSLDFNPTCAISN----YNDANEVRNCELVGLRDLNQGNSYVQDKVVEFLDHL-IDLGVAGF 201
               ..||::|:....|    ....|.....:..|..|::..|..||.::.|:::.| .::|..|:
plant   139 ---DRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPRVQKELSEWMNWLKTEIGFHGW 200

  Fly   202 RVDAAKHMWPADLAVIYGRLKNLNTDHGFASGSK--------------------AYIVQEVIDMG 246
            |.|..:. :.:.:..:|.:    ||...||.|.|                    :.:.|.:.:.|
plant   201 RFDYVRG-YASSITKLYVQ----NTSPDFAVGEKWDDMKYGGDGKLDYDQNEHRSGLKQWIEEAG 260

  Fly   247 GEAISKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAA--SDRSLVFVDNHDNQR 309
            |..::..::|..|.:    .|...|:::|.||      :.|...|...  ...::.|:||||..|
plant   261 GGVLTAFDFTTKGIL----QSAVKGELWRLKD------SQGKPPGMIGIMPGNAVTFIDNHDTFR 315

  Fly   310 GHGAGGADVLTYKVPK-QYKMASAFMLAHPFGTP 342
                      |:..|. :..:...::|.|| |||
plant   316 ----------TWVFPSDKVLLGYVYILTHP-GTP 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 78/360 (22%)
Alpha-amylase 54..342 CDD:278554 70/324 (22%)
Aamy_C 405..493 CDD:214749
AMY1NP_567714.1 PLN00196 5..422 CDD:165762 78/360 (22%)
AmyAc_arch_bac_plant_AmyA 28..372 CDD:200453 78/360 (22%)
Alpha-amyl_C2 362..422 CDD:129046
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2599
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D665362at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.