DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Amy-d and C50B6.7

Sequence 1:NP_523768.1 Gene:Amy-d FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_506303.1 Gene:C50B6.7 WormBaseID:WBGene00008220 Length:713 Species:Caenorhabditis elegans

Alignment Length:500 Identity:218/500 (44%)
Similarity:292/500 (58%) Gaps:39/500 (8%)


  Fly    22 TNYASGRSGMVHLFEWKWDDIAAECENFLGPNGYAGVQVSPVNENA---VKDSRPWWERYQPISY 83
            |.....|..|||||||||.|:|.||||||...||..|||||..|:.   ..::.|||.||||:||
 Worm    25 TQTLQNRQTMVHLFEWKWADVAKECENFLQYYGYGAVQVSPPMEHLKAFPNNNYPWWVRYQPVSY 89

  Fly    84 KLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAADGGTYGTG-GSTASPS------SKSYPG 141
            ||::|||||::|..||.|||.||||..||:|.|||...|...|.| ||:.|.|      .:|:||
 Worm    90 KLDSRSGNEQEFQDMVNRCNKVGVRIIVDIVMNHMVGIGQKSGNGVGSSGSSSFDGTHGVQSFPG 154

  Fly   142 VPYSSLDF-NPTC----AISNY-NDANEVRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAG 200
            ||||..|| ||.|    ..|:| |.|..|::|.||||.||||.::.|:.|:|.:|:.|:|:||||
 Worm   155 VPYSLGDFNNPKCDGDIQGSDYQNSAEHVKDCRLVGLLDLNQASATVRAKIVAYLNKLVDMGVAG 219

  Fly   201 FRVDAAKHMWPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAISKSEYTGLGAITEFR 265
            ||.||:|||||.|:..|...:|:|.:|. :.|..:.:.|.||||.||||:...:|.|.|..|.|.
 Worm   220 FRHDASKHMWPQDILNILNDVKDLRSDI-YGSNQRPFAVHEVIDRGGEAVKCGDYFGNGRYTNFN 283

  Fly   266 HSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRS--LVFVDNHDNQRGHGAGGADVLTYKVPKQYK 328
            ...::....:.:...:||.|.|..:|:..::..  |.|:|||||||.   ....|:|||..::|.
 Worm   284 FGAAVSAAAKQQSDWKYLANLGPGYGYGNNEDHDVLNFIDNHDNQRD---SSPYVVTYKDGQKYN 345

  Fly   329 MASAFMLAHPFGTPRVMSSFSFTDTDQGPPTTDGHN---IASPIFNSDNSC--SGGWVCEHRWRQ 388
            :|..||||.|:|.|||||||:|:.:||.||.:...|   ..||.||.|.:|  :.||||||||..
 Worm   346 LAVGFMLAWPYGYPRVMSSFAFSYSDQSPPNSGASNDYATTSPTFNGDQTCNSNSGWVCEHRWPA 410

  Fly   389 IYNMVAFRNAV----GLDEIQNWWDSGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLPAGTYCD 449
            |..|..||:||    ..|.:     :.:.:|:|:|..:||.|.|..:........|.||||.|||
 Worm   411 IRQMAKFRSAVQGTAAADIV-----TDTRRIAFARDGKGFFALNQQDGAWTKIFATNLPAGDYCD 470

  Fly   450 VISGSKSGSSCTGKTVTVGSDGRASIYIGSSEDDGVLAIHVNAKL 494
            ..||......|.|..:||..|..:.:.:.|   :.::||.:::||
 Worm   471 HFSGGLDNGKCVGTKITVRDDHTSYLSVPS---NSIVAISLDSKL 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 188/394 (48%)
Alpha-amylase 54..342 CDD:278554 138/306 (45%)
Aamy_C 405..493 CDD:214749 25/88 (28%)
C50B6.7NP_506303.1 AmyAc_bac_euk_AmyA 31..421 CDD:200456 188/394 (48%)
AmyA 53..>354 CDD:223443 137/305 (45%)
Aamy_C 432..511 CDD:214749 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131086137
eggNOG 1 0.900 E1_COG0366
Hieranoid 1 1.000
Homologene 1 1.000 H134663
Inparanoid 1 1.050 384 1.000 Inparanoid score I1157
Isobase 1 0.950 0 Normalized mean entropy S3326
OMA 1 1.010
OrthoDB 1 1.010 D231864at33208
OrthoFinder 1 1.000 FOG0000464
OrthoInspector 1 1.000 T375102
orthoMCL 1 0.900 OOG5_128640
Panther 1 1.100 LDO PTHR43447
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4468
TreeFam 1 0.960
1413.840

Return to query results.
Submit another query.