DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fat-spondin and CG17739

Sequence 1:NP_477435.1 Gene:fat-spondin FlyBaseID:FBgn0026721 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster

Alignment Length:829 Identity:279/830 (34%)
Similarity:388/830 (47%) Gaps:127/830 (15%)


  Fly     3 QSLPLLIRLIVVIWLTISMVTACPRAPTHLNHGRRTRGDNGYKLIVADGPNGYVPGKTYNLLLLG 67
            :...:|:.|:.|    |..:..|.|.|..:...:....|| |.|.|......||||:.||:    
  Fly     5 EGFTILLALVGV----IPRIEGCIRVPPGVTAAKSPVDDN-YVLSVNGNTQSYVPGQRYNV---- 60

  Fly    68 SRTHLKVQHFTHFTITAEAHTGARRPQAASPRRVGRFQLFSDSLTQFNDRCVNTVSEADDLPKTE 132
            |.:......|..|.:..:..:|.....|   ..:|.:::...:.|:|:.||.|.|...:...||.
  Fly    61 SLSAFSGLSFISFMLALDLESGDGDGDA---NALGTWEIADLAETRFSPRCPNLVENTNTNVKTR 122

  Fly   133 VQVMWVAPES-GSGCVSLSAMVYEGPRAWFADDGNLSTVICERKPDAAAAQKE----CCACDEAK 192
            |.|.||||.| |.||:.|.|.|.:....||.|||.|:..:||.:.|....|..    ||||||||
  Fly   123 VDVFWVAPSSPGQGCILLRATVMQHRDVWFMDDGFLTKRMCEEEVDDIDTQPSIVDPCCACDEAK 187

  Fly   193 YSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAEWGSPAALE 257
            |...|||.||..|||||:|...|.|.|||:|||||..::.||....:|:.|.|.:||.||...||
  Fly   188 YELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLE 252

  Fly   258 TELRANGPKLRTLIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSMFGPSPDWVVGISGLDLCTE 322
            :||:.....:||:|||.|:.||||...|.:.||||..|..:|||||..|||||:||:|||:||..
  Fly   253 SELKDQSEHIRTIIKARGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVGVSGLELCLP 317

  Fly   323 DCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITTMYPEDPRAPFYNPKSREMTPLA 387
            :|||.|:...:|:|||||||||.||||.:....||:.:.||.:.:|.|||:|||:|...:|.|||
  Fly   318 NCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDPTGAQMKPLA 382

  Fly   388 KLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTRAECRVGDYSAWSPCSVSCGKGIRMRSRQY 452
            .|::.|.::..:||:           |.|:|:  ...||....:|.|..|:..||.|.:.|.|::
  Fly   383 TLHINRRRLYEKNCE-----------SSDSEQ--VPPECATNSWSRWDECTTKCGPGKQYRIREF 434

  Fly   453 LYPAAADQNKCARQLVAKEMCV-------------AAIPECADGPAQSKDRDDDEGENLANSQSL 504
            ..||.|.:::|...|..::.||             ...||.|..|..|   ||.:          
  Fly   435 KNPALASRHRCNNALREEKNCVGHKCAGFNEETAEGGEPEVAPSPGSS---DDPQ---------- 486

  Fly   505 VGSNGEGAGLCKTSPWSVWSECSASCGIGITMRTRTFVNHLGRKRCP-------HITIV------ 556
                      |..|.||.||.|:.:||.|...|:|.::|...:|:|.       |.|.:      
  Fly   487 ----------CGLSDWSEWSSCTVTCGTGEMTRSRHYLNKKAKKKCQKASRARLHETKICEAMEC 541

  Fly   557 --------------------------EKNKCMRPDCTYEQVE---LPDPQCPTSQWSDWSPCSST 592
                                      ||....|...:|.|..   :| |.|..:.|||:|||...
  Fly   542 GGDIENEGGAGEPEEEQAGGDGGGSAEKRSIFRNFESYSQHREDYIP-PVCGVTPWSDFSPCMGP 605

  Fly   593 C-GRGVTIRTRLLLLEN--------GPDKESCTQRMELHQQKECVNPIDCHINAEQAKDICVQAP 648
            | |.|...|.|.:...|        ..|.:...:.::||::..|.|| .|.   ......|....
  Fly   606 CGGHGKRQRIRKVWNNNQVYGVTDPNDDGQDPCRHIKLHEEVNCTNP-SCD---TIVPGFCYDEL 666

  Fly   649 DPGPCRGTYMR--YAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVLRSPYSSRVDQPRA- 710
            ...|||...:.  :.||..:..|..:....|..|||.|.::.:|..||.:.|.....:.|...| 
  Fly   667 TDSPCRDNDVANFWYYDHVSDQCAIYWSDRCDTNRNKFKSKEECEETCRLPRHKQELQHDGIPAI 731

  Fly   711 -CVLSDWSVWSPCSVSCGVGVSESRRYVVTEPQNGGQPCSKRLVKSRSC 758
             |::||| |...|:.|||.|.....|.|:..|:.||:||.|.||:...|
  Fly   732 DCLVSDW-VSHSCNASCGDGFQLRTRRVLRTPKYGGKPCPKHLVRLDRC 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fat-spondinNP_477435.1 Reeler 24..172 CDD:260081 47/149 (32%)
Spond_N 191..378 CDD:283999 99/187 (53%)
TSP1 428..473 CDD:214559 13/45 (29%)
TSP1 518..566 CDD:214559 19/87 (22%)
TSP1 581..627 CDD:214559 15/55 (27%)
Kunitz_BPTI 643..694 CDD:278443 14/53 (26%)
TSP1 714..763 CDD:214559 20/46 (43%)
CG17739NP_610757.1 Reeler 23..163 CDD:260081 47/148 (32%)
Spond_N 186..373 CDD:283999 99/187 (53%)
TSP1 412..460 CDD:214559 15/48 (31%)
TSP1 490..541 CDD:214559 16/51 (31%)
KU 661..715 CDD:294074 15/54 (28%)
TSP_1 815..862 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 1 1.000 FOG0003736
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 P PTHR11311
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3762
65.940

Return to query results.
Submit another query.