DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and SmydA-2

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_649084.1 Gene:SmydA-2 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster

Alignment Length:517 Identity:141/518 (27%)
Similarity:225/518 (43%) Gaps:104/518 (20%)


  Fly    13 EIKQNDTLGRFAVALCNVRAGETLLLENPIVVLPLMGE---------------------RRCSKC 56
            ||..|:.|||...|..:::.||.:|.|.|:|:.|.:..                     .:||.|
  Fly    50 EIATNEVLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSC 114

  Fly    57 FNLTESFCRKCRLLALCEDCSDHDERDCKRLAEMNFSDDQVELLQKKEHTE----IQPVLKCLLL 117
               :...|.|     .||| |.|.:.:|:.::..||......:..::|..|    :..:|:|:.|
  Fly   115 ---SWPLCGK-----ECED-SVHHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHL 170

  Fly   118 REHEET--LPLYEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLDYGGVLAQLRGAADEDLVQGLLG 180
            ::.:..  |.||    .::..|..|..|.:::..:.:..|   :...:..::...:.|::: :..
  Fly   171 KDKDPDAFLKLY----NLEDHLKERLETPLYQVLRANLIT---FIKTVLGMKDWPEMDILR-IAA 227

  Fly   181 ILDINAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISIDDEQRIKVYANRFIAAGEILYNCYT 245
            |||.|.:|:|.|.....:|.||..|.:.:|.|.||:....||:..|...|.|.||.||||...||
  Fly   228 ILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNMRHRFDDDMNIVFLAKRKIAKGEILSISYT 292

  Fly   246 NVLLGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDGYIVR-QP--DTGIWQC 307
            ..|..|.:||..|:..|||||||.|||||.|||:...:..|.:|..  |.|:. .|  ::..|:|
  Fly   293 QPLRSTIQRRVHLRQAKCFDCSCARCQDPEELGSFAGAQTCLKCKA--GKIISLNPLLNSAPWKC 355

  Fly   308 LLNPEHTLKQEFVSNMLERAKEEIFHARDDIYRQEL-LLAK-----LSRLLHRNHFLMLDLKQNI 366
            .|           .|....||:.:  ..|...:||| .|.|     |...::|:.   .||.:..
  Fly   356 QL-----------CNFKRSAKDVV--TSDAELQQELESLDKTTPVALEEFIYRHR---ADLHETN 404

  Fly   367 ASILR---QILQNMGTRPNKKVYE-------RKIRLCQEILLVLKVVTPGISRLKA---IALYEL 418
            ..||:   .:.|..|:.|...:.|       ||::||:|:|.:..:...|.|..:.   |.:.|.
  Fly   405 THILQAKYALTQLYGSAPGFAMEELSGESLNRKLQLCEELLKLADIFDGGWSIFRGNLLIDMEEA 469

  Fly   419 ANTQ-----------------AELARKMYTEMEHSANDLLAELERVEVMLRESLRMLLFEPL 463
            ..||                 ||:.|::...|:|........||| :|:|..:|..  |||:
  Fly   470 LVTQALRSKDPLDCEEKLRNAAEMLREIRNIMKHEPEMQQLLLER-QVILSSALER--FEPV 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 26/65 (40%)
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 19/45 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 1 0.950 0 Normalized mean entropy S4564
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.