DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and SmydA-7

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001261039.1 Gene:SmydA-7 FlyBaseID:FBgn0034182 Length:488 Species:Drosophila melanogaster

Alignment Length:519 Identity:163/520 (31%)
Similarity:260/520 (50%) Gaps:76/520 (15%)


  Fly     7 DFARKCEIKQNDTLGRFAVALCNVRAGETLLLENPIVVLP--LMGERRCSKCFNLTESFCRKCRL 69
            :|....:...::.|||..||...:..|:|:|.|.|::|.|  ...:.:|::|...:...||:|::
  Fly     3 EFGENIQHAHDEKLGRHLVASIAIEPGDTILEERPLLVAPHWECHQLKCAQCLQESYVICRRCQV 67

  Fly    70 LALCEDCSDHDERD------------CKRLAEMNFSDDQVELLQKKEHTEIQPVLKCLLLREHEE 122
            ..||.||:.|||.:            ||.:...||.              |..:||.|||.|:..
  Fly    68 FPLCMDCNQHDEFECEFFTSGAGKALCKDILVKNFG--------------ICGLLKLLLLLENPR 118

  Fly   123 TLPLYEEMSQMDSQLMT---------RRGTEVWKNYQEHAFTPLDYGGVLAQLRGAADEDLVQGL 178
            |        :.|.|::.         |.|..:|:.::|....||...|:...|   ..::|....
  Fly   119 T--------KGDCQMLIDVPINLSDYRDGEGMWQEHEELVVRPLMESGLADVL---PTQELTSDA 172

  Fly   179 LGI----LDINAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISIDDEQRIKVYANRFIAAGEI 239
            |..    :|.|::|:.|.: |..::|::.......|.|.||.|:::|::..:|:||...:..|:|
  Fly   173 LHAHCIRIDSNSFEVTAKD-GDTLKGIFVWGATLPHHCVPNTVVALDEQFNMKLYAAVPLQPGDI 236

  Fly   240 LYNCYTNVLLGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDGYIVRQPDT-- 302
            :||.|||.|:||.:|:..|::.:..:|.|.||.||||:||||||..|.:|   .|:.|.:.|:  
  Fly   237 IYNSYTNPLMGTSQRQHQLRLSRRLECICSRCLDPTEMGTHMSSLKCKEC---PGFSVCEIDSNG 298

  Fly   303 --GIWQC-----LLNPE--HTLKQEFVSNMLERAKEEIFHARDDIYRQELLLAKLSRLLHRNHFL 358
              |.|:|     ||...  |.|:....|.:::        |..|:...|.||.:...|||.|||:
  Fly   299 KLGDWRCPDCRALLTAAEVHELQAAVGSALVD--------AMGDLQVYEALLTQYGPLLHPNHFM 355

  Fly   359 MLDLKQNIASILR-QILQNMGTRPNKKVYERKIRLCQEILLVLKVVTPGISRLKAIALYELANTQ 422
            :||:||||||||| ..|.|...:|.||:..|::.||.::|.|.:.|.||||:|.||.|:|.....
  Fly   356 LLDIKQNIASILRAAALMNSMDQPCKKLLARRVELCSDLLPVCRAVVPGISKLYAIGLFEYLLAL 420

  Fly   423 AELARKMYTEMEHSANDLLAELERVEVMLRESLRMLLFEPLATPEGQLTRSMLRELKELQDDIK 486
            .||....:.|.:.|..:.:|.|....::..|::.:|.|||..:.||.|...:..||:.::.|:|
  Fly   421 VELVELQFAESDLSKKEYVAHLRTASLVATEAMDLLRFEPENSAEGYLADRISMELERIESDLK 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 20/69 (29%)
SmydA-7NP_001261039.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.