DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and SmydA-5

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster

Alignment Length:533 Identity:147/534 (28%)
Similarity:244/534 (46%) Gaps:67/534 (13%)


  Fly    10 RKC---EIKQNDTLGRFAVALCNVRAGETLLLENPIVV---------------LPLMGERRCSKC 56
            |:|   ..:|:..|||:.....|:.||:.:.:|.|:||               :|.:|   |...
  Fly    41 RRCRPFSEEQDAELGRYLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASNVPCVG---CYTP 102

  Fly    57 FNLTESFCRKCRLLALCEDCSDHDERDCKRLAEMNFSDDQVELLQKKEH--TEIQPVLKCLLLRE 119
            ..|.:..||:|| ..:|.....|:..:|..|:..:.|..:.:.....::  .:...|||||||:.
  Fly   103 CRLGKHQCRRCR-WPVCSAGCKHESMECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLLLQR 166

  Fly   120 HEETLPLYEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLDYGGVLAQLRGA-------ADEDLVQG 177
            ...|  .:..:.:|.|....|:||::::..::...|.|. ...|.:|:..       ...:::..
  Fly   167 QSPT--KWSALLEMQSHEEERKGTDLYEEAEKRVVTYLQ-KRFLCRLKQTNPNLLTDCGPEMLHR 228

  Fly   178 LLGILDINAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISIDDE-QRIKVYANRFIAAGEILY 241
            |.||::.|...|..|. |..:.||:|:|.:..|:|.||.....|:: |::.|.|...:..|:.|.
  Fly   229 LCGIIETNFMVIELPS-GVELSGLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLR 292

  Fly   242 NCYTNVLLGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFIC----SQCSCVDGYIVRQP-- 300
            ..|||:|.||:.|:..|::.|.|.|.|.||.||||.||::|:..|    :| :|...::...|  
  Fly   293 ITYTNILWGTQLRQHHLRLTKHFSCRCSRCLDPTEYGTYISALTCLGDVNQ-TCGGTHLPVDPLD 356

  Fly   301 DTGIWQCLLNP---EHTLKQEFVSNMLERAKEEIFHARDDIYRQELLLAKLSRLLHRNHFLMLDL 362
            :...|:|...|   :.....|..|:|.|:. |.:........:.|||||:|:.:||.|||...:|
  Fly   357 ENTQWKCDTCPMIVDGAYVAELQSHMTEQV-EGLLAGCPSANQVELLLARLTHMLHPNHFHTFNL 420

  Fly   363 KQNIASILRQILQN-----MGTRPNKKVYERKIRLCQEILLVLKVVTPGISRLK---AIALYELA 419
            |..    |.|:..|     :|...|.:: |||:|||.|:..|.:.:.|...:|.   .:.|.|:|
  Fly   421 KHT----LIQLYGNEAGLELGVLSNTQL-ERKLRLCGELYNVCRRLDPYSIKLAIYVTVILIEVA 480

  Fly   420 NTQAELARKMYTEMEHSANDLLAELERVEVMLRESLRMLLFEPLATPEGQLTRSMLRELKELQDD 484
            :|..|.||:...|    ...||.   ..:..|||:..:|..|..:....:|...:..|:.|.:..
  Fly   481 HTLQEQARRAPAE----GTSLLG---LAQSRLREAHMVLEKEQESVAGKKLNEKLQMEIFECEKL 538

  Fly   485 IKNLRESDDDVVN 497
            |..|..:.|...|
  Fly   539 ILALAYNQDHEAN 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 20/66 (30%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 1/2 (50%)
SET 185..295 CDD:279228 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.