DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and SmydA-3

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster

Alignment Length:521 Identity:158/522 (30%)
Similarity:240/522 (46%) Gaps:78/522 (15%)


  Fly    14 IKQNDTLGRFAVALCNVRAGETLLLENPIVVLP-LMGERRCSKCF----NLTESFCRKCRLLALC 73
            ::.:...||:.||...:|....|:.|.|..|.| ..|...|..|:    :..|..|.:|. ..||
  Fly    14 VQWSPVCGRYLVAKGAIRGHGLLIEELPFAVGPKCNGPVVCLGCYEPNPDPEEELCSECG-WPLC 77

  Fly    74 EDCSDHDERDCKRLAEMNFSDDQVELLQKKEHTEIQPVLKC------LLLRE------HEETLPL 126
            .:|:...:....||......|.:....:....:...|.|.|      ||.:|      ..|..|:
  Fly    78 VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLAKEANPERWDNEVAPM 142

  Fly   127 --YEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLDYGGVLAQLRGAA------DEDLVQGLLGILD 183
              ::|..|.|:        :||     ||    |...:...|||..      .|:|:..::|:|:
  Fly   143 EHHKEERQRDA--------DVW-----HA----DRVNIAQYLRGPCQLANRFSEELIMQVVGVLE 190

  Fly   184 INAYEIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISI--DDEQRIKVYANRFIAAGEILYNCYTN 246
            :||:|.|:|: |..:|.|:...|:.||:|.||...||  .:..:|::.|...:..|:.|::.||.
  Fly   191 VNAFEARSPK-GYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTY 254

  Fly   247 VLLGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDGYIV----RQPDTGIWQC 307
            .|.||.:|:|.||.||.|.|.|.||.||||||||.||..|.||:  :|:.|    .:|||. |.|
  Fly   255 TLDGTAQRQKHLKQGKFFTCQCERCLDPTELGTHFSSLKCGQCA--EGFQVPRQPTEPDTS-WNC 316

  Fly   308 LLNPEHTLKQEFVSNMLERAKEEIF------HARDDIYRQELLLAKLSRLLHRNHFLMLDLKQNI 366
            ......|...:.:: ||:..:.|:.      .|...:...|.||.|...|||..||        |
  Fly   317 ANCGSDTSNADALA-MLQSLQSEVNAVQALPMAAKRLEEIERLLRKYKSLLHPLHF--------I 372

  Fly   367 ASILRQILQNMGTR---------PNKKVYERKIRLCQEILLVLKVVTPGISRLKAIALYELANTQ 422
            |:.|||:|..|..|         |:.:: |||..||:::|.||....||:||.:|:.||||....
  Fly   373 ATGLRQLLIEMYGRVQGYEMVQLPDHQL-ERKAELCRQVLRVLNTFEPGLSRTRAMNLYELHVPL 436

  Fly   423 AELARKMYTEMEHSANDLLAELERVEVMLRESLRMLLFEPLATPEGQLTRSMLRELKELQDDIKN 487
            ..||:..:...:....:|.|.|.....:|:|.:.:|.||..::.||.|.....:.||:|...::.
  Fly   437 VLLAKSGFIAGKLKGGELRARLVDAIDLLKECVEILEFEDKSSQEGVLCVVAKQALKQLTLSVEG 501

  Fly   488 L 488
            |
  Fly   502 L 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 22/67 (33%)
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.