DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and SmydA-4

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster

Alignment Length:498 Identity:144/499 (29%)
Similarity:226/499 (45%) Gaps:51/499 (10%)


  Fly    14 IKQNDTLGRFAVALCNVRAGETLLLENPIVVLP-LMGERRCSKCFN-----LTESFCRKCRLLAL 72
            ::.:|..||:.||...:.|||||:.|.|:.:.| :.|:..|..|::     ..:..|..|.....
  Fly    51 VEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGCAWPLC 115

  Fly    73 CEDCS------DHDERDCKRLAEMNFSDDQVELL-------QKKEHTEIQPVLKCLLLREHE-ET 123
            ...|:      .|.|.:|:..||......  |||       :.::..|:..:::.||||:|: |.
  Fly   116 GSTCAGLKHRHGHTETECQLYAERRAVAG--ELLTERAGPAEVRDLYELVMIVRILLLRQHDPEQ 178

  Fly   124 LPLYEEMSQMDSQLMTRRGTEV-WKNYQEHAFTPLDYGGVLAQLRGAADEDLVQGLLGILDINAY 187
            ..|   :::|:|....||...| |::|:|.....|.....|..|    :.:.|..:.||||:|.:
  Fly   179 FAL---IARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDL----EAEQVHEVCGILDVNCF 236

  Fly   188 EIRAPEVGGAMRGLYRRAGLFAHSCTPNLVISIDDEQ-RIKVYANRFIAAGEILYNCYTNVLLGT 251
            ||  .:.|...|.||..|.|.||.||||...:.|... .|.:..:|.:...|.|...|...|.||
  Fly   237 EI--GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFEILLRTSRRVREREALTLSYAYTLQGT 299

  Fly   252 EERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDGYIVRQPD----TGIWQCLLNPE 312
            .:||..:..||.|.|.|.||.||.||||..|:.:|:.|....   ||..|    ||.|.| ....
  Fly   300 LKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGS---VRAVDPLQQTGDWAC-DRCA 360

  Fly   313 HTLKQEFVSNMLERAKEEI----FHARDDIYRQELLLAKLSRLLHRNHFLMLDLKQNIASILRQI 373
            |.:....|...|:|...::    .|   ||...|..|.:...:|..||:|:|..|.::..|..:.
  Fly   361 HKMGATEVERQLDRINNDLEDIDVH---DIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQIYGRT 422

  Fly   374 LQNMGTRPNKKVYERKIRLCQEILLVLKVVTPGISRLKAIALYELANTQAELARKMYTEMEHSAN 438
            ...:..:.:.:...||...|:|.|.::.|:.||::||:.:.:|||......||:..:...:.|..
  Fly   423 EGYLLPQMSPEDIARKESYCREFLEIVDVLDPGLTRLRGLIMYELHAPVMVLAQSAFQSGQISRQ 487

  Fly   439 DLLAELERVEVMLRESLRMLLFEPLATPE---GQLTRSMLREL 478
            :....|:.|..:|:.|..:||.||..:.|   ||.....|.::
  Fly   488 EFQRRLKEVVKLLQVSRDILLMEPEGSTENAMGQAAADALSKM 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 24/66 (36%)
SmydA-4NP_572675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.