DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and Smyd4

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001096081.1 Gene:Smyd4 MGIID:2442796 Length:799 Species:Mus musculus

Alignment Length:613 Identity:117/614 (19%)
Similarity:204/614 (33%) Gaps:217/614 (35%)


  Fly    21 GRFAVALCNVRAGETLLLENPIVVLPLMGER-RCSKCF------NLT--ESFCRKCRLLAL---- 72
            ||..||..::..||.|:.|:..|.:.:.||. |...|.      .:|  :.:|.:|....|    
Mouse   244 GRHLVATKDILPGELLVKEDAFVSVLIPGEMPRPHHCLENKWDTRVTSGDLYCHRCLKHTLATVP 308

  Fly    73 CEDCS--DHDERDCKRLA-EMNFSDD------------------QVELLQKKEHTEIQPVLKCL- 115
            |..||  .:..::|.:.| ::..|.:                  ::.||.:.|  ::..|::.| 
Mouse   309 CGSCSYAKYCSQECMQQAWDLYHSTECSLGGLLLTLGVFCHVALRMTLLARFE--DVDRVVRMLC 371

  Fly   116 --------LLREHEETLPLYEEMSQMDSQLMTRRG--------------------------TEVW 146
                    .|.|.:..:..::..||.:|:..::.|                          ||  
Mouse   372 DEVGSTDTCLPESKNLVKAFDYTSQGESEEKSKIGEPPIPGCNVNGKYGSNYNAIFSLLPHTE-- 434

  Fly   147 KNYQEHAF-TPLDYGGVLAQLRGAADEDLVQGLLGILDINAYEIRAPEV--------------GG 196
            |:..||.| ..:....:..||:  ||           .:.|..:::|::              |.
Mouse   435 KHSPEHRFICAISVSALCRQLK--AD-----------SVQAQTLKSPKLKAVTPGLCADLTVWGA 486

  Fly   197 AM------------------------------------RGLYRRAGLFAHSCTPNLVISIDDEQR 225
            ||                                    .|::....|..|||.||..:|..... 
Mouse   487 AMLRHMLQLQCNAQAITSICHTGSNESIITNSRQIRLATGIFPVVSLLNHSCRPNTSVSFTGTV- 550

  Fly   226 IKVYANRFIAAGEILYNCY--TNVLLGTEERRKILKVGKCFDCSCPRCQDPT---ELGTHMSSFI 285
            ..|.|.:.||.|:.:.:||  ....:|..||::.|.....|||.|..|...|   .......:|.
Mouse   551 ATVRAAQRIAKGQEILHCYGPHESRMGVAERQQRLSSQYFFDCRCGACHAETLRAAAAPRWEAFC 615

  Fly   286 CSQCSCVDGYIVRQPDTGIWQCLLNPEHTLKQEFVSNMLERAKEEIFHARDDIYRQELLLAKLSR 350
            |..|..:      .....:..|        ..|..:|.:.|               :.|:::|. 
Mouse   616 CKTCRAL------MQGNDVLSC--------SNESCTNSVSR---------------DQLVSRLQ- 650

  Fly   351 LLHRNHFLMLDLKQNIASILRQILQNMGTRPNKKVYERKIRLCQEIL--------LVLKVVTPGI 407
                      ||:|.:.  :.|.|...| :|.:.:  :::..|:|..        .||..:..|:
Mouse   651 ----------DLQQQVC--MAQKLLRTG-KPEQAI--QQLLRCREAAESFLSAEHTVLGEIEDGL 700

  Fly   408 SRLKAIA---LYELANTQAELARKMYTEMEH--SANDLLAELERVEVMLRESLRMLLFEPLATPE 467
            ::..|..   |...|:.|..|   ...|..|  |:.::..||.:        |..:||..||.||
Mouse   701 AQAHATLGNWLKSAAHVQKSL---QVVETRHGPSSVEIGHELFK--------LAQVLFNGLAVPE 754

  Fly   468 G-----QLTRSMLRELKELQDDIKNLRE 490
            .     :..|.:|.......::::.|||
Mouse   755 ALSAIWKAERILLVHCGPESEEVRELRE 782

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 19/115 (17%)
Smyd4NP_001096081.1 TPR_11 68..132 CDD:290150
TPR repeat 68..96 CDD:276809
TPR repeat 101..136 CDD:276809
S-adenosyl-L-methionine binding. {ECO:0000250} 112..114
zf-MYND 296..335 CDD:280009 9/39 (23%)
SET <524..570 CDD:279228 15/47 (32%)
S-adenosyl-L-methionine binding. {ECO:0000250} 535..536 0/1 (0%)
TPR_12 658..725 CDD:290160 14/73 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.